PSD93 Antibody - BSA Free

Immunohistochemistry-Paraffin: PSD93 Antibody [NBP1-88088] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: PSD93 Antibody [NBP1-88088] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Immunohistochemistry-Paraffin: PSD93 Antibody [NBP1-88088] - Staining in human cerebral cortex and pancreas tissues.. Corresponding DLG2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PSD93 Antibody [NBP1-88088] - Staining of human pancreas shows no positivity as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PSD93 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLVDDDYTRPPEPVYSTVNKLCDKP
• Marker: post-Synaptic Marker
• Predicted Species: Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DLG2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PSD93 Protein (NBP1-88088PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PSD93 Antibody - BSA Free

• Chapsyn-110
• discs, large homolog 2 (Drosophila)
• discs, large homolog 2, chapsyn-110 (Drosophila)
• discs, large homolog 2, chapsyn-110
• disks large homolog 2
• DKFZp781D1854
• DKFZp781E0954
• FLJ37266
• MGC131811
• Postsynaptic density protein PSD-93
• PSD-93
• PSD93,110kDa

Background

Post Synaptic Density 93 (PSD 93), also known as chapsyn-110, is one of a family of plasma membrane-associated proteins found in synaptic junctions. PSD 93 is unique among family members in its expression in Purkinje neuron cell bodies and dendrites. PSD 93 has three ~90 amino acid repeats called PDZ domains, a single interior SH3 domain, and a carboxyl-terminal guanylate kinase homology (GuK) domain that is enzymatically inactive. It is hypothesized that PDZ-domain interactions play a role in receptor and channel clustering which contributes to neuronal plasticity.PSD 93 is believed to participate in the clustering of certain proteins, including N-methyl-D-aspartate (NMDA) receptors and shaker-type potassium channels at the synaptic membrane. There are two principal modes of interaction between PSD 93 and other proteins. NMDA receptors and shaker-type potassium channels both share C-terminal sequence homology consisting of a threonine/serine-X-valine-COOH (T/SXV) motif. Other neuronal proteins that share this motif (beta 1 adrenergic receptor, some serotonin receptors, some sodium channel subunits, and additional potassium channel subunits) may interact with PSD 93 by binding to its PDZ domains. Neuronal nitric oxide synthase (nNOS), which lacks the T/SXV motif but which has its own PDZ domain, has been shown to associate with PSD 93 in vitro through a pseudo-homotypic PDZ-PDZ interaction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DLG2