PSCA Antibody (1E1)

Western Blot: PSCA Antibody (1E1) [H00008000-M02] - Analysis of PSCA expression in transfected 293T cell line by PSCA monoclonal antibody (M02), clone 1E1.Lane 1: PSCA transfected lysate(12.9 KDa).Lane 2: Non-transfected lysate.

ELISA: PSCA Antibody (1E1.) [H00008000-M02] - PSCA Antibody (1E1) [H00008000-M02] - Detection limit for recombinant GST tagged PSCA is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1E1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

PSCA Antibody (1E1) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PSCA (NP_005663, 23 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS
• Marker: Prostate Stem Cell Marker
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PSCA
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: It has been used for ELISA and WB.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PSCA Antibody (1E1)

• PRO232
• prostate stem cell antigen
• PSCA

Background

This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene has a nonsynonymous nucleotide polymorphism at its start codon.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSCA
• Uniprot:
  • NP_005663(Human)