PRR7 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit PRR7 Antibody - BSA Free (NBP2-13815) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: MSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAPPCPALCLQADRGRRVFPSWTDSELSSREPLEHGAWRLPVSIP |
| Predicted Species |
Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PRR7 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PRR7 Antibody - BSA Free
Background
PRR7/TRAP3 (proline-rich 7, transmembrane adaptor protein 3) is a 28 kDa transmembrane adaptor protein ubiquitously expressed at low level (most in brain). Its amino acid sequence is extremely conserved among mammalian and other species. PRR7/TRAP3 contains potential palmitoylation motif and is found in lipid rafts. It is a part of the complex postsynaptic density fraction in neurons and associates with PSD-95, NMDA receptor and probably other proteins. The intracellular domain of PRR7/TRAP3 contains several tyrosines, a proline-rich sequence, and a C-terminal PDZ-binding motif. So far nothing is known about function of this protein. It may be involved in regulation of some receptor signaling and in formation of neurologic and immunologic synapse.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for PRR7 Antibody (NBP2-13815) (0)
There are no publications for PRR7 Antibody (NBP2-13815).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PRR7 Antibody (NBP2-13815) (0)
There are no reviews for PRR7 Antibody (NBP2-13815).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PRR7 Antibody (NBP2-13815) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PRR7 Products
Blogs on PRR7