PRR13 Antibody - BSA Free

Western Blot: PRR13 Antibody [NBP1-92299] - Analysis in control (vector only transfected HEK293T lysate) and PRR13 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: PRR13 Antibody [NBP1-92299] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

Analysis in human cell line CACO-2.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PRR13 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PRR13 Antibody - BSA Free (NBP1-92299) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRR13
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:10-1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PRR13 Protein (NBP1-92299PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PRR13 Antibody - BSA Free

• DKFZP564J157
• FLJ23818
• proline rich 13
• proline-rich protein 13
• Taxane-resistance protein
• TXR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRR13