Protein S/PROS1 Antibody (3D7)

Images

 
Western Blot: Protein S/PROS1 Antibody (3D7) [H00005627-M01] - Detection against Immunogen (36.52 KDa) .

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Protein S/PROS1 Antibody (3D7) Summary

Immunogen
PROS1 (NP_000304, 419 a.a. ~ 516 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLLETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRP
Localization
Secreted
Specificity
PROS1 - protein S (alpha)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PROS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Protein S/PROS1 Antibody (3D7)

  • EC 3.4.21
  • PROS
  • PROS1
  • protein S (alpha)
  • Protein S
  • protein Sa
  • PS21
  • PS22
  • PS23
  • PS24
  • PS25
  • PSA
  • vitamin K-dependent plasma protein S
  • vitamin K-dependent protein S

Background

Protein S is a vitamin K dependent anticoagulant protein. Its major function is as a cofactor to facilitate the action of activated protein C (APC) on its substrates, activated factor V (FVa), and activated factor VIII (FVIIIa). Protein S deficiencies are associated with thrombosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DKK300
Species: Hu
Applications: ELISA
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DY262
Species: Hu
Applications: ELISA
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24614
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
NBP1-87345
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87343
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-48909
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
NBP3-04411
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: IHC, IHC-P, WB
NBP1-45057
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-06046
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-15184
Species: Hu, Rt
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, Simple Western
NBP1-89284
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
H00005627-M01
Species: Hu
Applications: WB, ELISA

Publications for Protein S/PROS1 Antibody (H00005627-M01) (0)

There are no publications for Protein S/PROS1 Antibody (H00005627-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein S/PROS1 Antibody (H00005627-M01) (0)

There are no reviews for Protein S/PROS1 Antibody (H00005627-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protein S/PROS1 Antibody (H00005627-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protein S/PROS1 Products

Bioinformatics Tool for Protein S/PROS1 Antibody (H00005627-M01)

Discover related pathways, diseases and genes to Protein S/PROS1 Antibody (H00005627-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protein S/PROS1 Antibody (H00005627-M01)

Discover more about diseases related to Protein S/PROS1 Antibody (H00005627-M01).
 

Pathways for Protein S/PROS1 Antibody (H00005627-M01)

View related products by pathway.

PTMs for Protein S/PROS1 Antibody (H00005627-M01)

Learn more about PTMs related to Protein S/PROS1 Antibody (H00005627-M01).

Blogs on Protein S/PROS1

There are no specific blogs for Protein S/PROS1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protein S/PROS1 Antibody (3D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol PROS1
Entrez
OMIM
Uniprot