Protein phosphatase 1 inhibitor 3D Antibody - BSA Free

Immunohistochemistry-Paraffin: Protein phosphatase 1 inhibitor 3D Antibody [NBP1-87235] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Protein phosphatase 1 inhibitor 3D Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Protein phosphatase 1 inhibitor 3D Antibody - BSA Free (NBP1-87235) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ELAQVKVFNAGDDPSVPLHVLSRLAINSDLCCSSQDLEFTLHCLVPDFPPPVEAADFGERLQRQLVCLERVTCSDL
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP1R3D
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Protein phosphatase 1 inhibitor 3D Protein (NBP1-87235PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Protein phosphatase 1 inhibitor 3D Antibody - BSA Free

• DKFZp781L2441
• PP1 subunit R6
• PPP1R6
• protein phosphatase 1 regulatory subunit 3D
• protein phosphatase 1 regulatory subunit 6
• protein phosphatase 1, regulatory subunit 3D
• protein phosphatase 1, regulatory subunit 6, spinophilin
• protein phosphatase 1-binding subunit R6
• regulatory (inhibitor) subunit 3D

Background

Phosphorylation of serine and threonine residues in proteins is a crucial step in the regulation of many cellular functions ranging from hormonal regulation to cell division and even short-term memory. The level of phosphorylation is controlled by the opposing actions of protein kinases and protein phosphatases. Protein phosphatase 1 (PP1) is 1 of 4 major serine/threonine-specific protein phosphatases which have been identified in eukaryotic cells. PP1 associates with various regulatory subunits that dictate its subcellular localization and modulate its substrate specificity. Several subunits that target PP1 to glycogen have been identified. This gene encodes a glycogen-targeting subunit of PP1. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP1R3D