Protein phosphatase 1 inhibitor 3D Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Protein phosphatase 1 inhibitor 3D Antibody [NBP1-87235] - Staining of human cell line U-2 OS shows positivity in nucleoli, cytoplasm and mitochondria.
Immunohistochemistry-Paraffin: Protein phosphatase 1 inhibitor 3D Antibody [NBP1-87235] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Protein phosphatase 1 inhibitor 3D Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ELAQVKVFNAGDDPSVPLHVLSRLAINSDLCCSSQDLEFTLHCLVPDFPPPVEAADFGERLQRQLVCLERVTCSDL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP1R3D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Protein phosphatase 1 inhibitor 3D Protein (NBP1-87235PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Protein phosphatase 1 inhibitor 3D Antibody

  • DKFZp781L2441
  • PP1 subunit R6
  • PPP1R6
  • protein phosphatase 1 regulatory subunit 3D
  • protein phosphatase 1 regulatory subunit 6
  • protein phosphatase 1, regulatory subunit 3D
  • protein phosphatase 1, regulatory subunit 6, spinophilin
  • protein phosphatase 1-binding subunit R6
  • regulatory (inhibitor) subunit 3D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87236
Species: Hu
Applications: WB, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NBP1-82243
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59934
Species: Hu
Applications: WB
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-52539
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-32858
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88447
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24490
Species: Hu, Ca, Eq, Pm
Applications: WB, IHC-P
NBP1-31365
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34170
Species: Hu
Applications: IHC, IHC-P
MAB3000
Species: Hu, Mu, Rt
Applications: WB
NBP1-91191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38367
Species: Hu
Applications: IB, ICC/IF, IHC, IHC-P
NBP1-87235
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for Protein phosphatase 1 inhibitor 3D Antibody (NBP1-87235) (0)

There are no publications for Protein phosphatase 1 inhibitor 3D Antibody (NBP1-87235).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein phosphatase 1 inhibitor 3D Antibody (NBP1-87235) (0)

There are no reviews for Protein phosphatase 1 inhibitor 3D Antibody (NBP1-87235). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Protein phosphatase 1 inhibitor 3D Antibody (NBP1-87235) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protein phosphatase 1 inhibitor 3D Products

Bioinformatics Tool for Protein phosphatase 1 inhibitor 3D Antibody (NBP1-87235)

Discover related pathways, diseases and genes to Protein phosphatase 1 inhibitor 3D Antibody (NBP1-87235). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protein phosphatase 1 inhibitor 3D Antibody (NBP1-87235)

Discover more about diseases related to Protein phosphatase 1 inhibitor 3D Antibody (NBP1-87235).
 

Pathways for Protein phosphatase 1 inhibitor 3D Antibody (NBP1-87235)

View related products by pathway.

Blogs on Protein phosphatase 1 inhibitor 3D

There are no specific blogs for Protein phosphatase 1 inhibitor 3D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protein phosphatase 1 inhibitor 3D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R3D