![Western Blot: TTC7B Antibody [NBP2-31715] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10, Lane 2: Human cell line HEL](http://images.novusbio.com/fullsize/TTC7B-Antibody-Western-Blot-NBP2-31715-img0010.jpg "Western Blot: TTC7B Antibody [NBP2-31715] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10, Lane 2: Human cell line HEL")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SECQWERIPELVKQLSAKLIANDDMAELLLGESKLEQYLKEHPLRQGASPRGPKPQLTEVRKHLTAALDRGNLKSEFLQESNLIMAKLNYVEGDY |
| Predicted Species | Mouse (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TTC7B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: TTC7B Antibody [NBP2-31715] - Analysis in human cerebral cortex and liver tissues using NBP2-31715 antibody. Corresponding TTC7B RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TTC7B-Antibody-Immunohistochemistry-Paraffin-NBP2-31715-img0009.jpg "Immunohistochemistry-Paraffin: TTC7B Antibody [NBP2-31715] - Analysis in human cerebral cortex and liver tissues using NBP2-31715 antibody. Corresponding TTC7B RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: TTC7B Antibody [NBP2-31715] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/TTC7B-Antibody-Immunohistochemistry-Paraffin-NBP2-31715-img0003.jpg "Immunohistochemistry-Paraffin: TTC7B Antibody [NBP2-31715] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry-Paraffin: TTC7B Antibody [NBP2-31715] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/TTC7B-Antibody-Immunohistochemistry-Paraffin-NBP2-31715-img0004.jpg "Immunohistochemistry-Paraffin: TTC7B Antibody [NBP2-31715] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: TTC7B Antibody [NBP2-31715] - Staining of human cerebral cortex shows strong positivity in neuropil.](http://images.novusbio.com/fullsize/TTC7B-Antibody-Immunohistochemistry-Paraffin-NBP2-31715-img0007.jpg "Immunohistochemistry-Paraffin: TTC7B Antibody [NBP2-31715] - Staining of human cerebral cortex shows strong positivity in neuropil.")
![Immunohistochemistry-Paraffin: TTC7B Antibody [NBP2-31715] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/TTC7B-Antibody-Immunohistochemistry-Paraffin-NBP2-31715-img0008.jpg "Immunohistochemistry-Paraffin: TTC7B Antibody [NBP2-31715] - Staining of human liver shows no positivity in hepatocytes as expected.")
![C1qR1/CD93 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "C1qR1/CD93 Antibody [Unconjugated]")
![N/A Thrombospondin-1 [HRP]](https://images.novusbio.com/images2/Thrombospondin-1_DTSP10_ELISA_199.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")