Protein mab-21-like 1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Protein mab-21-like 1 Antibody [NBP2-56150] - Staining of human cell line BJ shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Protein mab-21-like 1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVK
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAB21L1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Protein mab-21-like 1 Recombinant Protein Antigen (NBP2-56150PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Protein mab-21-like 1 Antibody

  • CAGR1mab-21 (C. elegans)-like 1
  • FLJ10197
  • mab-21-like 1 (C. elegans)
  • mab-21-like protein 1
  • protein mab-21-like 1

Background

Protein mab-21-like 1, or MAB21L1, consists of a 359 amino acid isoform that is 41 kDa, and is involved in embryonic development, especially with the eye and cerebellum. Current research is being conducted on Protein mab-21-like 1 and its relation to several disease and disorders, including neural tube defect, neuronitis, gastroesophageal reflux disease, neuroblastoma, and bipolar affective disorder. The protein has been linked to the positive regulation of cell proliferation and anatomical structure morphogenesis, as well as eye and embryonic organ development. Protein mab-21-like 1 has been found to interact with INSR and SIRT3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Protein mab-21-like 1 Antibody (NBP2-56150) (0)

There are no publications for Protein mab-21-like 1 Antibody (NBP2-56150).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein mab-21-like 1 Antibody (NBP2-56150) (0)

There are no reviews for Protein mab-21-like 1 Antibody (NBP2-56150). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Protein mab-21-like 1 Antibody (NBP2-56150) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protein mab-21-like 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAB21L1