Protein mab-21-like 1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Protein mab-21-like 1 Antibody - BSA Free (NBP2-56150) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVK |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MAB21L1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Protein mab-21-like 1 Antibody - BSA Free
Background
Protein mab-21-like 1, or MAB21L1, consists of a 359 amino acid isoform that is 41 kDa, and is involved in embryonic development, especially with the eye and cerebellum. Current research is being conducted on Protein mab-21-like 1 and its relation to several disease and disorders, including neural tube defect, neuronitis, gastroesophageal reflux disease, neuroblastoma, and bipolar affective disorder. The protein has been linked to the positive regulation of cell proliferation and anatomical structure morphogenesis, as well as eye and embryonic organ development. Protein mab-21-like 1 has been found to interact with INSR and SIRT3.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA, BA
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
Species: Ca, Hu, Pm
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF
Publications for Protein mab-21-like 1 Antibody (NBP2-56150) (0)
There are no publications for Protein mab-21-like 1 Antibody (NBP2-56150).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Protein mab-21-like 1 Antibody (NBP2-56150) (0)
There are no reviews for Protein mab-21-like 1 Antibody (NBP2-56150).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Protein mab-21-like 1 Antibody (NBP2-56150) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Protein mab-21-like 1 Products
Blogs on Protein mab-21-like 1