Protein mab-21-like 1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Protein mab-21-like 1 Antibody [NBP2-56150] - Staining of human cell line BJ shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Protein mab-21-like 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Protein mab-21-like 1 Antibody - BSA Free (NBP2-56150) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVK
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAB21L1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Protein mab-21-like 1 Recombinant Protein Antigen (NBP2-56150PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Protein mab-21-like 1 Antibody - BSA Free

• CAGR1mab-21 (C. elegans)-like 1
• FLJ10197
• mab-21-like 1 (C. elegans)
• mab-21-like protein 1
• protein mab-21-like 1

Background

Protein mab-21-like 1, or MAB21L1, consists of a 359 amino acid isoform that is 41 kDa, and is involved in embryonic development, especially with the eye and cerebellum. Current research is being conducted on Protein mab-21-like 1 and its relation to several disease and disorders, including neural tube defect, neuronitis, gastroesophageal reflux disease, neuroblastoma, and bipolar affective disorder. The protein has been linked to the positive regulation of cell proliferation and anatomical structure morphogenesis, as well as eye and embryonic organ development. Protein mab-21-like 1 has been found to interact with INSR and SIRT3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAB21L1