Protein kinase-like protein SgK493 Antibody - BSA Free

Western Blot: Protein kinase-like protein SgK493 Antibody [NBP1-80758] - Analysis in control (vector only transfected HEK293T lysate) and PKDCC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry: Protein kinase-like protein SgK493 Antibody [NBP1-80758] - Staining of human nasopharynx shows moderate membranous positivity in ciliated cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Protein kinase-like protein SgK493 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Protein kinase-like protein SgK493 Antibody - BSA Free (NBP1-80758) is a polyclonal antibody validated for use in IHC and WB. Anti-Protein kinase-like protein SgK493 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TEYQCIPDSTIPQEDYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVVPDPNKTT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PKDCC
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Protein kinase-like protein SgK493 Protein (NBP1-80758PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Protein kinase-like protein SgK493 Antibody - BSA Free

• EC 2.7
• FLJ18197
• MGC125960
• protein kinase domain containing, cytoplasmic homolog (mouse)
• protein kinase domain-containing protein, cytoplasmic
• Protein kinase-like protein SgK493
• SgK493
• Sugen kinase 493
• Vertebrate lonesome kinase
• Vlk

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Protein kinase-like protein SgK493 Antibody (NBP1-80758)(2)

Publications using NBP1-80758

• Klein I, Boenert J, Lange F et al. Glia from the central and peripheral nervous system are differentially affected by paclitaxel chemotherapy via modulating their neuroinflammatory and neuroregenerative properties Frontiers in pharmacology 2022-11-02 [PMID: 36408236]
• Wang K, Cui X, Li F et al. Glucagon receptor blockage inhibits beta -cell dedifferentiation through FoxO1 American journal of physiology. Endocrinology and metabolism 2022-11-16 [PMID: 36383639] (IHC-P, Mouse)

Bioinformatics

• Gene Symbol: PKDCC
• Entrez:
  • 91461(Human)
• Uniprot:
  • Q504Y2(Human)