Proteasome subunit beta type 4 Antibody

Images

 
Western Blot: Proteasome subunit beta type 4 Antibody [NBP1-89681] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Proteasome subunit beta type 4 Antibody [NBP1-89681] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells(chief cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Proteasome subunit beta type 4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMB4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Proteasome subunit beta type 4 Protein (NBP1-89681PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Proteasome subunit beta type 4 Antibody

  • EC 3.4.25.1
  • HN3
  • hsBPROS26
  • HsN3
  • Macropain beta chain
  • Multicatalytic endopeptidase complex beta chain
  • PROS26PROS-26
  • proteasome (prosome, macropain) subunit, beta type, 4
  • Proteasome beta chain
  • Proteasome chain 3
  • proteasome subunit beta type-4
  • proteasome subunit HsN3
  • proteasome subunit, beta type, 4,26 kDa prosomal protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45808
Species: Hu
Applications: IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
355-BM/CF
Species: Hu, Mu, Rt
NBP1-31354
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55915
Species: Hu
Applications: WB, ICC/IF
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
H00005956-R02
Species: Hu
NBP1-32510
Species: Hu
Applications: WB
NBP1-03349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89428
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-13820
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-89681
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Proteasome subunit beta type 4 Antibody (NBP1-89681) (0)

There are no publications for Proteasome subunit beta type 4 Antibody (NBP1-89681).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome subunit beta type 4 Antibody (NBP1-89681) (0)

There are no reviews for Proteasome subunit beta type 4 Antibody (NBP1-89681). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proteasome subunit beta type 4 Antibody (NBP1-89681) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Proteasome subunit beta type 4 Products

Bioinformatics Tool for Proteasome subunit beta type 4 Antibody (NBP1-89681)

Discover related pathways, diseases and genes to Proteasome subunit beta type 4 Antibody (NBP1-89681). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome subunit beta type 4 Antibody (NBP1-89681)

Discover more about diseases related to Proteasome subunit beta type 4 Antibody (NBP1-89681).
 

Pathways for Proteasome subunit beta type 4 Antibody (NBP1-89681)

View related products by pathway.

PTMs for Proteasome subunit beta type 4 Antibody (NBP1-89681)

Learn more about PTMs related to Proteasome subunit beta type 4 Antibody (NBP1-89681).
 

Research Areas for Proteasome subunit beta type 4 Antibody (NBP1-89681)

Find related products by research area.

Blogs on Proteasome subunit beta type 4

There are no specific blogs for Proteasome subunit beta type 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Proteasome subunit beta type 4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMB4