Proteasome subunit beta type 4 Antibody


Western Blot: Proteasome subunit beta type 4 Antibody [NBP1-54586] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Proteasome subunit beta type 4 Antibody Summary

Synthetic peptides corresponding to PSMB4(proteasome (prosome, macropain) subunit, beta type, 4) The peptide sequence was selected from the middle region of PSMB4 (NP_002787). Peptide sequence SRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQ.
This product is specific to Subunit or Isoform: beta type-4.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PSMB4 and was validated on Western blot.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Proteasome subunit beta type 4 Antibody

  • EC
  • HN3
  • hsBPROS26
  • HsN3
  • Macropain beta chain
  • Multicatalytic endopeptidase complex beta chain
  • PROS26PROS-26
  • proteasome (prosome, macropain) subunit, beta type, 4
  • Proteasome beta chain
  • Proteasome chain 3
  • proteasome subunit beta type-4
  • proteasome subunit HsN3
  • proteasome subunit, beta type, 4,26 kDa prosomal protein


The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB4 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
Species: Hu
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, IP, PLA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
Species: Hu
Applications: WB, Simple Western, IHC, IP
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
Species: Hu
Applications: WB

Publications for Proteasome subunit beta type 4 Antibody (NBP1-54586) (0)

There are no publications for Proteasome subunit beta type 4 Antibody (NBP1-54586).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome subunit beta type 4 Antibody (NBP1-54586) (0)

There are no reviews for Proteasome subunit beta type 4 Antibody (NBP1-54586). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proteasome subunit beta type 4 Antibody (NBP1-54586) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Proteasome subunit beta type 4 Products

Bioinformatics Tool for Proteasome subunit beta type 4 Antibody (NBP1-54586)

Discover related pathways, diseases and genes to Proteasome subunit beta type 4 Antibody (NBP1-54586). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome subunit beta type 4 Antibody (NBP1-54586)

Discover more about diseases related to Proteasome subunit beta type 4 Antibody (NBP1-54586).

Pathways for Proteasome subunit beta type 4 Antibody (NBP1-54586)

View related products by pathway.

PTMs for Proteasome subunit beta type 4 Antibody (NBP1-54586)

Learn more about PTMs related to Proteasome subunit beta type 4 Antibody (NBP1-54586).

Research Areas for Proteasome subunit beta type 4 Antibody (NBP1-54586)

Find related products by research area.

Blogs on Proteasome subunit beta type 4

There are no specific blogs for Proteasome subunit beta type 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Proteasome subunit beta type 4 Antibody and receive a gift card or discount.


Gene Symbol PSMB4