Proteasome 26S S5 Antibody

Images

 
Western Blot: Proteasome 26S S5 Antibody [NBP1-87800] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Proteasome 26S S5 Antibody [NBP1-87800] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: Proteasome 26S S5 Antibody [NBP1-87800] - Staining of human prostate shows strong nuclear positivity in glandular cells.
Western Blot: Proteasome 26S S5 Antibody [NBP1-87800] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Proteasome 26S S5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AAQALALLREVARLEAPLEELRALHSVLQAVPLNELRQQAAELRLGPLFSLLNENHREKTTLCVSILERLLQAMEPVHVARNLRVDLQRGLIHPDDSVKILTLSQIGRIVENSDAVTEILNNAELLKQIVYCIGGENLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMD5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Proteasome 26S S5 Protein (NBP1-87800PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Proteasome 26S S5 Antibody

  • KIAA007226S proteasome non-ATPase regulatory subunit 5
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 5,26S proteasome subunit S5B
  • S5BMGC23145,26S protease subunit S5 basic

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12553
Species: Hu
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80961
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-82310
Species: Hu
Applications: WB, IHC, IHC-P
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1834
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
AF5540
Species: Mu
Applications: WB
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
AF4779
Species: Hu
Applications: WB, IHC
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Proteasome 26S S5 Antibody (NBP1-87800) (0)

There are no publications for Proteasome 26S S5 Antibody (NBP1-87800).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 26S S5 Antibody (NBP1-87800) (0)

There are no reviews for Proteasome 26S S5 Antibody (NBP1-87800). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Proteasome 26S S5 Antibody (NBP1-87800) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Proteasome 26S S5 Products

Bioinformatics Tool for Proteasome 26S S5 Antibody (NBP1-87800)

Discover related pathways, diseases and genes to Proteasome 26S S5 Antibody (NBP1-87800). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome 26S S5 Antibody (NBP1-87800)

Discover more about diseases related to Proteasome 26S S5 Antibody (NBP1-87800).
 

Pathways for Proteasome 26S S5 Antibody (NBP1-87800)

View related products by pathway.

Research Areas for Proteasome 26S S5 Antibody (NBP1-87800)

Find related products by research area.

Blogs on Proteasome 26S S5

There are no specific blogs for Proteasome 26S S5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Proteasome 26S S5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMD5