Prolyl Oligopeptidase/PREP Antibody

Images

 
Immunohistochemistry: Prolyl Endopeptidase Antibody [NBP2-32014] - Staining of human stomach, upper shows strong cytoplasmic positivity in granular pattern in glandular cells.
Immunohistochemistry: Prolyl Endopeptidase Antibody [NBP2-32014] - Staining of human stomach, upper shows strong cytoplasmic positivity in granular pattern in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Prolyl Oligopeptidase/PREP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IACVRSNFLVLCYLHDVKNILQLHDLTTGALLKTFPLDVGSIVGYSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PREP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Prolyl Oligopeptidase/PREP Protein (NBP2-32014PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Prolyl Oligopeptidase/PREP Antibody

  • dJ355L5.1 (prolyl endopeptidase)
  • EC 3.4.21.26
  • MGC16060
  • PE
  • PEP
  • Post-proline cleaving enzyme
  • PREP
  • prolyl endopeptidase
  • Prolyl Oligopeptidase
  • rPop

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07799
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005554-R02
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-32789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32014
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for Prolyl Oligopeptidase/PREP Antibody (NBP2-32014) (0)

There are no publications for Prolyl Oligopeptidase/PREP Antibody (NBP2-32014).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prolyl Oligopeptidase/PREP Antibody (NBP2-32014) (0)

There are no reviews for Prolyl Oligopeptidase/PREP Antibody (NBP2-32014). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Prolyl Oligopeptidase/PREP Antibody (NBP2-32014) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Prolyl Oligopeptidase/PREP Products

Bioinformatics Tool for Prolyl Oligopeptidase/PREP Antibody (NBP2-32014)

Discover related pathways, diseases and genes to Prolyl Oligopeptidase/PREP Antibody (NBP2-32014). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prolyl Oligopeptidase/PREP Antibody (NBP2-32014)

Discover more about diseases related to Prolyl Oligopeptidase/PREP Antibody (NBP2-32014).
 

Pathways for Prolyl Oligopeptidase/PREP Antibody (NBP2-32014)

View related products by pathway.

PTMs for Prolyl Oligopeptidase/PREP Antibody (NBP2-32014)

Learn more about PTMs related to Prolyl Oligopeptidase/PREP Antibody (NBP2-32014).

Blogs on Prolyl Oligopeptidase/PREP

There are no specific blogs for Prolyl Oligopeptidase/PREP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prolyl Oligopeptidase/PREP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PREP
Entrez
Uniprot