Prohibitin Antibody (4B12-2G12)

Images

 
Immunocytochemistry/ Immunofluorescence: Prohibitin Antibody (4B12-2G12) [H00005245-M02] - Analysis of monoclonal antibody to PHB on HeLa cell. Antibody concentration 15 ug/ml.
Sandwich ELISA: Prohibitin Antibody (4B12-2G12) [H00005245-M02] - Detection limit for recombinant GST tagged PHB is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4B12-2G12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Prohibitin Antibody (4B12-2G12) Summary

Immunogen
PHB (AAH13401, 1 a.a. - 272 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVVFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAGDIAYQLSRSRNITYLPAGQSVLLQLPQ
Marker
Mitochondria Marker
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PHB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Prohibitin Antibody (4B12-2G12)

  • PHB
  • PHB1
  • Prohibitin

Background

Prohibitin is an evolutionarily conserved protein located in the inner membrane of mitochondria.
Prohibitin shows antiproliferative activity and has been proposed to play a role in normal cell cycle regulation, replicative senescence, cellular immortalization and tumor suppression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-85786
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46477
Species: Hu, Ca
Applications: WB, IHC, IF
NBP1-82609
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
44260002
Species: Hu
Applications: WB, ELISA
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88561
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Prohibitin Antibody (H00005245-M02) (0)

There are no publications for Prohibitin Antibody (H00005245-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prohibitin Antibody (H00005245-M02) (0)

There are no reviews for Prohibitin Antibody (H00005245-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Prohibitin Antibody (H00005245-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Prohibitin Products

Bioinformatics Tool for Prohibitin Antibody (H00005245-M02)

Discover related pathways, diseases and genes to Prohibitin Antibody (H00005245-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prohibitin Antibody (H00005245-M02)

Discover more about diseases related to Prohibitin Antibody (H00005245-M02).
 

Pathways for Prohibitin Antibody (H00005245-M02)

View related products by pathway.

PTMs for Prohibitin Antibody (H00005245-M02)

Learn more about PTMs related to Prohibitin Antibody (H00005245-M02).
 

Research Areas for Prohibitin Antibody (H00005245-M02)

Find related products by research area.

Blogs on Prohibitin

There are no specific blogs for Prohibitin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prohibitin Antibody (4B12-2G12) and receive a gift card or discount.

Bioinformatics

Gene Symbol PHB
Entrez
Uniprot