Profilin 1 Recombinant Protein Antigen

Images

 
There are currently no images for Profilin 1 Recombinant Protein Antigen (NBP2-59778PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Profilin 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PFN1

Source: E. coli

Amino Acid Sequence: KSIGGAPTFNVTVTKTDKTLVLLMGKEGIHG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PFN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-59778.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Profilin 1 Recombinant Protein Antigen

  • PFN1
  • PROF1
  • Profilin 1
  • Profilin I
  • profilin-1

Background

Profilin is an ubiquitous small (12-15 kDa) phosphoinositides and poly-L-proline binding protein that plays a role both in signal transduction pathways and actin filament dynamics. There are two mammalian profilins with similar biochemical properties but different expression patterns. Whereas profilin I appears to be highly expressed in most tissues except for skeletal muscle, profilin II is predominantly expressed in brain and at lower levels. It is also in expressed in skeletal muscle, the uterus and kidneys. Profilin is a mainly cytosolic protein with higher concentrations in dynamic membrane areas like the leading edge and ruffling membranes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87426
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00555
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87914
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00010097-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-82512
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
MAB8170
Species: Hu, Mu, Rt
Applications: IHC, KO, mIF, Simple Western, WB
AF1444
Species: Mu
Applications: IHC, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NB600-231
Species: Hu
Applications: IHC, IHC-P, KD, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00527
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB

Publications for Profilin 1 Recombinant Protein Antigen (NBP2-59778PEP) (0)

There are no publications for Profilin 1 Recombinant Protein Antigen (NBP2-59778PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Profilin 1 Recombinant Protein Antigen (NBP2-59778PEP) (0)

There are no reviews for Profilin 1 Recombinant Protein Antigen (NBP2-59778PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Profilin 1 Recombinant Protein Antigen (NBP2-59778PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Profilin 1 Products

Research Areas for Profilin 1 Recombinant Protein Antigen (NBP2-59778PEP)

Find related products by research area.

Blogs on Profilin 1.

Profiling the Profilin 1 Antibody
Profilin-1, or Pfn-1, is a small actin-binding protein which plays an essential role controlling the growth of microfilaments. Profilin 1 and Profilin 2 have similar biochemical properties but are expressed in different tissues. The Profilin 1 antibod...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Profilin 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PFN1