Proenkephalin Antibody - BSA Free

Immunohistochemistry: Proenkephalin Antibody [NBP3-38239] - Immunohistochemistry analysis of paraffin-embedded Human prostate using Proenkephalin Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Proenkephalin Antibody [NBP3-38239] - Immunofluorescence analysis of paraffin-embedded Human adrenal gland using Proenkephalin Rabbit pAb at dilution of 1:20 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: Proenkephalin Antibody [NBP3-38239] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using Proenkephalin Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: Proenkephalin Antibody [NBP3-38239] - Western blot analysis of lysates from THP-1 cells, using Proenkephalin Rabbit pAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 120s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Proenkephalin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Proenkephalin Antibody - BSA Free (NBP3-38239) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-267 of human Proenkephalin (NP_001129162.1).
  
  Sequence:
  ECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PENK
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:100
  • Western Blot 1:100 - 1:500
• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for Proenkephalin Antibody - BSA Free

• enkephalin A
• preproenkephalin
• proenkephalin
• proenkephalin-A

Background

Enkephalins are small peptides derived from large precursers (pro-enkephalin A and B) containing multiple enkephalin copies. They are the most abundant opioid peptides in the body and are widely distributed in the brain and the peripheral nervous system and occur also in the adrenal medulla. Several types of neuroendocrine tumors, including pheochromocytomas, neuroblastomas and bronchial and gastrointestinal endocrine tumors, produce enkephalin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PENK