Procalcitonin Recombinant Protein Antigen

Images

 
There are currently no images for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Procalcitonin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Procalcitonin

Source: E.coli

Amino Acid Sequence: SKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVS

Protein/Peptide Type
Recombinant Protein Antigen
Gene
CALCA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP3-16983. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Procalcitonin Recombinant Protein Antigen

  • CALC1
  • CALCA
  • Calcitonin 1
  • calcitonin gene-related peptide 1
  • CGRP
  • Katacalcin
  • Procalcitonin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7665
Species: Hu
Applications: IHC, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-46349
Species: Hu
Applications: IHC, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp, Ze
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
MAB4077
Species: Hu
Applications: IHC, WB
D6050
Species: Hu
Applications: ELISA
H00138428-P01
Species: Hu
Applications: ELISA, AP, PA, WB
DCRP00
Species: Hu
Applications: ELISA
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF6108
Species: Hu
Applications: IHC
NLS6731
Species: Bv, Ca, Eq, Gt, Ha, Hu, Pm, Po, Pm, Rb, Rt, Xp
Applications: IHC, IHC-P
DCP00
Species: Hu
Applications: ELISA
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-33680
Species: Hu
Applications: IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP3-16983PEP
Species: Hu
Applications: AC

Publications for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP) (0)

There are no publications for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP) (0)

There are no reviews for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Procalcitonin Products

Bioinformatics Tool for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP)

Discover related pathways, diseases and genes to Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP)

Discover more about diseases related to Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP).
 

Pathways for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP)

View related products by pathway.

PTMs for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP)

Learn more about PTMs related to Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP).
 

Research Areas for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP)

Find related products by research area.

Blogs on Procalcitonin

There are no specific blogs for Procalcitonin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Procalcitonin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CALCA