PRMT6 Antibody


Immunocytochemistry/ Immunofluorescence: PRMT6 Antibody [NBP2-32459] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: PRMT6 Antibody [NBP2-32459] - Staining of human kidney shows strong nuclear positivity in renal tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

PRMT6 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: WKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAME
Specificity of human PRMT6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PRMT6 Protein (NBP2-32459PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PRMT6 Antibody

  • EC 2.1.1.-
  • EC
  • FLJ10559
  • FLJ51477
  • Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6
  • Histone-arginine N-methyltransferase PRMT6
  • HMT1 hnRNP methyltransferase-like 6 (S. cerevisiae)
  • HMT1 hnRNP methyltransferase-like 6
  • HRMT1L6
  • protein arginine methyltransferase 6
  • protein arginine N-methyltransferase 6


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PRMT6 Antibody (NBP2-32459) (0)

There are no publications for PRMT6 Antibody (NBP2-32459).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRMT6 Antibody (NBP2-32459) (0)

There are no reviews for PRMT6 Antibody (NBP2-32459). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PRMT6 Antibody (NBP2-32459) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PRMT6 Products

Bioinformatics Tool for PRMT6 Antibody (NBP2-32459)

Discover related pathways, diseases and genes to PRMT6 Antibody (NBP2-32459). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRMT6 Antibody (NBP2-32459)

Discover more about diseases related to PRMT6 Antibody (NBP2-32459).

Pathways for PRMT6 Antibody (NBP2-32459)

View related products by pathway.

PTMs for PRMT6 Antibody (NBP2-32459)

Learn more about PTMs related to PRMT6 Antibody (NBP2-32459).

Research Areas for PRMT6 Antibody (NBP2-32459)

Find related products by research area.

Blogs on PRMT6.

PRMT6: One Function, Many Roles
Protein arginine methylation is a prevalent posttranslational modification in eukaryotic cells. It regulates RNA processing, trafficking and nascent pre-RNA metabolism, receptor-mediated signal transduction, and transcriptional activation processes. P...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PRMT6 Antibody and receive a gift card or discount.


Gene Symbol PRMT6