PRKRIR Antibody

Images

 
Western Blot: PRKRIR Antibody [NBP1-85312] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: PRKRIR Antibody [NBP1-85312] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PRKRIR Antibody [NBP1-85312] - Staining of human rectum shows strong nuclear positivity in glandular cells.
Western Blot: PRKRIR Antibody [NBP1-85312] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRKRIR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NPHSRHRKRIKELSEDEIRTLKQKKIDETSEQEQKHKETNNSNAQNPSEEEGEGQDEDILPLTLEEKENKEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKRIR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
88 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
PRKRIR Protein (NBP1-85312PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRKRIR Antibody

  • 58 kDa interferon-induced protein kinase-interacting protein
  • DAP452 kDa repressor of the inhibitor of the protein kinase
  • Death-associated protein 4
  • inhibitor of protein kinase PKR
  • MGC102750
  • P52rIPK
  • p58IPK-interacting protein
  • protein-kinase, interferon-inducible double stranded RNA dependent inhibitor
  • repressor of (P58 repressor)
  • THAP domain-containing protein 0
  • THAP0

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-87760
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-40561
Species: Hu
Applications: WB, IP
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-87132
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33860
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-48308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-82617
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-45514
Species: Hu
Applications: WB, IHC
NBP2-58498
Species: Hu
Applications: ICC/IF

Publications for PRKRIR Antibody (NBP1-85312) (0)

There are no publications for PRKRIR Antibody (NBP1-85312).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRKRIR Antibody (NBP1-85312) (0)

There are no reviews for PRKRIR Antibody (NBP1-85312). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PRKRIR Antibody (NBP1-85312) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRKRIR Products

Bioinformatics Tool for PRKRIR Antibody (NBP1-85312)

Discover related pathways, diseases and genes to PRKRIR Antibody (NBP1-85312). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRKRIR Antibody (NBP1-85312)

Discover more about diseases related to PRKRIR Antibody (NBP1-85312).
 

Pathways for PRKRIR Antibody (NBP1-85312)

View related products by pathway.

PTMs for PRKRIR Antibody (NBP1-85312)

Learn more about PTMs related to PRKRIR Antibody (NBP1-85312).

Blogs on PRKRIR

There are no specific blogs for PRKRIR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRKRIR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKRIR
Entrez
Uniprot