PRKRIR Antibody - BSA Free

Western Blot: PRKRIR Antibody [NBP1-85312] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/Immunofluorescence: PRKRIR Antibody [NBP1-85312] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.

Western Blot: PRKRIR Antibody [NBP1-85312] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: PRKRIR Antibody [NBP1-85312] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.

Immunohistochemistry-Paraffin: PRKRIR Antibody [NBP1-85312] - Staining of human small intestine shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: PRKRIR Antibody [NBP1-85312] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: PRKRIR Antibody [NBP1-85312] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PRKRIR Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PRKRIR Antibody - BSA Free (NBP1-85312) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NPHSRHRKRIKELSEDEIRTLKQKKIDETSEQEQKHKETNNSNAQNPSEEEGEGQDEDILPLTLEEKENKEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: THAP12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 88 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  PRKRIR Protein (NBP1-85312PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PRKRIR Antibody - BSA Free

• 58 kDa interferon-induced protein kinase-interacting protein
• DAP452 kDa repressor of the inhibitor of the protein kinase
• Death-associated protein 4
• inhibitor of protein kinase PKR
• MGC102750
• P52rIPK
• p58IPK-interacting protein
• protein-kinase, interferon-inducible double stranded RNA dependent inhibitor
• repressor of (P58 repressor)
• THAP domain-containing protein 0
• THAP0

Background

PRKRIR encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: THAP12
• Entrez:
  • 5612(Human)
• Uniprot:
  • O43422(Human)