PRKRIR Antibody - Azide and BSA Free

Western Blot: PRKRIR Antibody [H00005612-B01P] - Analysis of PRKRIR expression in human colon.

Immunocytochemistry/Immunofluorescence: PRKRIR Antibody [H00005612-B01P] - Analysis of purified antibody to PRKRIR on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: PRKRIR Antibody [H00005612-B01P] - Analysis of PRKRIR expression in transfected 293T cell line by PRKRIR polyclonal antibody. Lane 1: PRKRIR transfected lysate(16.5 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PRKRIR Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: PRKRIR (AAH21992.1, 1 a.a. - 150 a.a.) full-length human protein. MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT
• Specificity: PRKRIR - protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: THAP12
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It is also useful for IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PRKRIR Antibody - Azide and BSA Free

• 58 kDa interferon-induced protein kinase-interacting protein
• DAP452 kDa repressor of the inhibitor of the protein kinase
• Death-associated protein 4
• inhibitor of protein kinase PKR
• MGC102750
• P52rIPK
• p58IPK-interacting protein
• protein-kinase, interferon-inducible double stranded RNA dependent inhibitor
• repressor of (P58 repressor)
• THAP domain-containing protein 0
• THAP0

Background

PRKRIR encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: THAP12
• Entrez:
  • 5612(Human)
• Uniprot:
  • AAH21992.1(Human)