Recombinant Human PRKCBP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PRKCBP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 601-698 of Human ZMYND8 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZMYND8

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PRKCBP1 Protein

  • ESP-2
  • HED-2
  • zyxin
  • zyxin-2

Background

PRKCBP1 - protein kinase C binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-42664
Species: Hu
Applications: WB, IHC, IP
NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2134
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85358
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-92323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-83900
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58940
Species: Hu
Applications: WB, ICC/IF
NBP2-20960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7305
Species: Hu, Mu, Rt
Applications: WB
NB100-757
Species: Hu
Applications: WB, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
27570002
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB100-74611
Species: Hu
Applications: WB, IHC-P, IP
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB600-240
Species: Hu
Applications: WB, IHC-P, PLA

Publications for PRKCBP1 Partial Recombinant Protein (H00023613-Q01) (0)

There are no publications for PRKCBP1 Partial Recombinant Protein (H00023613-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRKCBP1 Partial Recombinant Protein (H00023613-Q01) (0)

There are no reviews for PRKCBP1 Partial Recombinant Protein (H00023613-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRKCBP1 Partial Recombinant Protein (H00023613-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRKCBP1 Products

Bioinformatics Tool for PRKCBP1 Partial Recombinant Protein (H00023613-Q01)

Discover related pathways, diseases and genes to PRKCBP1 Partial Recombinant Protein (H00023613-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRKCBP1 Partial Recombinant Protein (H00023613-Q01)

Discover more about diseases related to PRKCBP1 Partial Recombinant Protein (H00023613-Q01).
 

Pathways for PRKCBP1 Partial Recombinant Protein (H00023613-Q01)

View related products by pathway.

Blogs on PRKCBP1

There are no specific blogs for PRKCBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PRKCBP1 Antibody
NBP1-87227

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PRKCBP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZMYND8