Presenilin-1 Recombinant Protein Antigen

Images

 
There are currently no images for Presenilin-1 Recombinant Protein Antigen (NBP2-57002PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Presenilin-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Presenilin-1.

Source: E. coli

Amino Acid Sequence: MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PSEN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57002.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Presenilin-1 Recombinant Protein Antigen

  • AD3EC 3.4.23.-
  • Alzheimer disease 3
  • EC 3.4.23
  • FAD
  • presenilin 1
  • Presenilin1
  • Presenilin-1
  • Protein S182
  • PS-1
  • PS1presenilin-1
  • PSEN1
  • PSNL1
  • S182

Background

Presenilin (PS) facilitates gamma-secretase cleavage of the beta-amyloid precursor protein and the intramembraneous cleavage of Notch1 (1). Presenilin (PS) is essential for the gamma-cleavage required for the generation of the C terminus of amyloid beta-protein (Abeta). The discovery that a deficiency of presenilin 1 (PS1) decreases the production of amyloid beta-protein (Abeta) identified the presenilins as important mediators of the gamma-secretase cleavage of beta-amyloid precursor protein (APP). It has been shown that two conserved transmembrane (TM) aspartates in PS1 are critical for Abeta production, providing evidence that PS either functions as a required diaspartyl cofactor for gamma-secretase or is itself gamma-secretase. Presenilin 2 (PS2) shares substantial sequence and possibly functional homology with PS1. It has been shown that the two TM aspartates in PS2 are also critical for gamma-secretase activity, providing further evidence that PS2 is functionally homologous to PS1 (2). PS are found primarily within intracellular membranes, including the endoplasmic reticulum (ER) and the trans-Golgi network as well as the plasma membrane. PS are also expressed in most cell types throughout development (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-74513
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-90813
Species: Hu
Applications: IHC,  IHC-P, WB
MAB931
Species: Hu, Mu
Applications: CyTOF-ready, IHC, ICFlow, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-75632
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF,  IHC-P, WB
MAB5378
Species: Hu
Applications: ICC
NB100-74360
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: EM, IHC,  IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP2-92892
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, KO, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-57002PEP
Species: Hu
Applications: AC

Publications for Presenilin-1 Recombinant Protein Antigen (NBP2-57002PEP) (0)

There are no publications for Presenilin-1 Recombinant Protein Antigen (NBP2-57002PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Presenilin-1 Recombinant Protein Antigen (NBP2-57002PEP) (0)

There are no reviews for Presenilin-1 Recombinant Protein Antigen (NBP2-57002PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Presenilin-1 Recombinant Protein Antigen (NBP2-57002PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Presenilin-1 Products

Research Areas for Presenilin-1 Recombinant Protein Antigen (NBP2-57002PEP)

Find related products by research area.

Blogs on Presenilin-1.

Mechanisms of Neurodegeneration: Protein aggregation and failure of autophagy
By Michalina Hanzel, PhDIn a series of three blog posts I will briefly explore the major cellular mechanisms responsible for many neurodegenerative disorders. The first, and perhaps the most apparent, is the accumulat...  Read full blog post.

Immunity’s flipside: Microglia promote Alzheimer’s pathology during inflammation
By Jamshed Arslan Pharm.D. Microglia are brain's macrophages. In Alzheimer's disease (AD), microglia clear up protein aggregates called amyloid beta plaques. The connection between immune activation and AD is unclea...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Presenilin-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PSEN1