Pref-1/DLK1/FA1 Antibody

Western Blot: Pref-1/DLK1/FA1 Antibody [NBP2-33697] - Analysis in human cell line HepG2.

Immunocytochemistry/Immunofluorescence: Pref-1/DLK1/FA1 Antibody [NBP2-33697] - Representative images and relative quantifications of immunofluorescent stainings showing DLK1 localization in U3082MG cells grown at 21% or 1% O2 for 48 h. In the whole figure significance is represented as *p < 0.05, **p < 0.01, and ***p < 0.001 vs. respective 21% O2 controls. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32205867/) licensed under a CC-BY license.

Product Discontinued

Pref-1/DLK1/FA1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LNKCETWVSNLRYNHMLRKKKNLLLQYNSGEDLAVNIIFPEKIDMTTFSKEA
• Predicted Species: Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DLK1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 1:100 - 1:250
• Application Notes: WB and IHC-P reported in the scientific literature: (PMID: 33142235)
• Control Peptide:

  Pref-1/DLK1/FA1 Protein (NBP2-33697PEP)

Reactivity Notes

Chicken reactivity reported in scientific literature (PMID:33142235).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Pref-1/DLK1/FA1 Antibody

• delta-like 1 homolog (Drosophila)
• DLK
• DLK1
• DLK-1
• FA1
• FA1fetal antigen 1
• pG2
• pG2delta-like homolog (Drosophila)
• preadipocyte factor 1
• Pref1
• Pref-1
• protein delta homolog 1
• secredeltin
• ZOG

Background

DLK1 may have a role in neuroendocrine differentiation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Pref-1/DLK1/FA1 Antibody (NBP2-33697)(1)

Publication using NBP2-33697

• Grassi E, Jeannot P, Pantazopoulou V et al. Niche-derived soluble DLK1 promotes glioma growth Neoplasia 2020-12-01 [PMID: 33142235] (IHC-P, WB, Chicken)

Review for Pref-1/DLK1/FA1 Antibody (NBP2-33697) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 08/09/2019

Summary

• Application: Western Blot
• Sample Tested: HEK293T cells overexpressing DLK1
• Species: Human
• Lot: A115297

Bioinformatics

• Gene Symbol: DLK1
• Uniprot:
  • P80370()