| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LNKCETWVSNLRYNHMLRKKKNLLLQYNSGEDLAVNIIFPEKIDMTTFSKEA |
| Predicted Species | Mouse (96%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DLK1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | WB and IHC-P reported in the scientific literature: (PMID: 33142235) |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-33697 | Applications | Species |
|---|---|---|
| Grassi E, Jeannot P, Pantazopoulou V et al. Niche-derived soluble DLK1 promotes glioma growth Neoplasia 2020-12-01 [PMID: 33142235] (IHC-P, WB, Chicken) | IHC-P, WB | Chicken |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 08/09/2019 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Pref-1/DLK1/FA1 Antibody (NBP2-33697)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.