| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse PRDC/GREM2 Antibody - Azide and BSA Free (H00064388-B01P) is a polyclonal antibody validated for use in WB. Anti-PRDC/GREM2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | GREM2 (AAH46632.1, 1 a.a. - 168 a.a.) full-length human protein. MFWKLSLSLFMVAVLVKVAEARKNRPAGAIHSPYKDGSSNNSERWQHQIKEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSCAFCKPQRVTSVLVELECPGLDPPFRLKKIQKVKQCRCMSVNLSDSDKQ |
| Specificity | GREM2 - gremlin 2, cysteine knot superfamily, homolog (Xenopus laevis), |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | GREM2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against transfected lysate for western blot. It has also been used for ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
| Publication using H00064388-B01P | Applications | Species |
|---|---|---|
| Wang J, Zheng L, Hu C et al. CircZFR promotes pancreatic cancer progression through a novel circRNA-miRNA-mRNA pathway and stabilizing epithelial-mesenchymal transition protein Cellular signalling 2023-03-27 [PMID: 36990335] (Western Blot, Human) | Western Blot | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for PRDC/GREM2 Antibody (H00064388-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GREM2 |
| Entrez |
|
| Uniprot |
|