PRAS40 Antibody - BSA Free

Immunohistochemistry-Paraffin: PRAS40 Antibody [NBP2-57165] - Immunohistochemical staining of human stomach shows cytoplasmic and nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PRAS40 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRK
• Predicted Species: Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AKT1S1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PRAS40 Recombinant Protein Antigen (NBP2-57165PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PRAS40 Antibody - BSA Free

• 40 kDa
• AKT1 substrate 1 (proline-rich)
• AKT1S1
• Lobe
• MGC2865
• PRAS40
• proline-rich AKT1 substrate 1,40 kDa proline-rich AKT substrate

Background

Proline Rich Akt Substrate (PRAS40) is a 40 kDa substrate of Akt. Akt and PRAS40 can be found in the phosphoinositide 3 kinase (PI3K) pathway, which plays a role in glucose uptake, cell growth, and apoptosis inhibition. PRAS40 is a 14-3-3 binding protein that reacts with insulin, but whose precise function is not yet known. It may bind SH3 and WW domain containing proteins resulting in a change of function. Activated Akt phosphorylates PRAS40 on threonine 246. Mutation of PRAS40 threonine 246 has been shown to be apoptotic.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AKT1S1