Home » PRAS40 » PRAS40 Research Products » PRAS40 Antibody

PRAS40 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: PRAS40 Antibody [NBP2-57165] - Immunohistochemical staining of human stomach shows cytoplasmic and nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: PRAS40 Antibody [NBP2-57165] - Immunohistochemical staining of human stomach shows cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PRAS40 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRK
Specificity
Specificity of human PRAS40 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKT1S1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRAS40 Recombinant Protein Antigen (NBP2-57165PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PRAS40 Antibody

  • 40 kDa
  • AKT1 substrate 1 (proline-rich)
  • AKT1S1
  • Lobe
  • MGC2865
  • PRAS40
  • proline-rich AKT1 substrate 1,40 kDa proline-rich AKT substrate

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TOR/mTOR [p
Ser2448] Antibody
NB600-607
Western Blot: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Rapamycin reduces mTOR phosphorylation induced by TII. Whole-cell lysates were prepared from astrocytes activated with TII for 2 h. 10 nM Rapamycin was added at the beginning of the experiment and equal amounts of protein were analyzed by western blot for phosphorylated mTOR kinase (p-mTOR) (upper gel) and consequently for beta-actin (lower gel). Image collected and cropped by CiteAb from the following publication (http://jneuroinflammation.biomedcentral.com/articles/10.1186/1742-2094-8-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Brown arrow= IBa1 positive cells, Green arrow= mTOR positive cells, Black arrow= mTOR and IBA1 positive cells. IHC-P Image submitted by a verified customer review.
Western Blot: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Detection of a 250 kDa band (indicated) corresponding to phosphorylated human mTOR present in a 293T whole cell lysates. Cells were serum-starved for 24 hours prior to harvest. 20 ug of lysate was loaded per lane for SDS-PAGE. Untreated cells are shown in lane 1, whereas cells in lane 2 were treated with IGF-1 (100 ng/ml) for 20 min prior to harvest. Follow reaction of antibody with a 1:2000 dilution of HRP Goat-a-Rabbit IgG for visualization.
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
RPTOR Antibody
NBP2-24837
Western Blot: RPTOR Antibody [NBP2-24837] - Analysis of Raptor in A) human 293 and B) mouse NIH 3T3 lysate using Raptor antibody at 1:2000.
Immunocytochemistry/Immunofluorescence: RPTOR Antibody [NBP2-24837] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-RPTOR at a 1:100 overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: RPTOR Antibody [NBP2-24837] - Analysis of human small intestine using Raptor antibody at 1:100.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
4EBP1 Antibody
NB200-157
Knockout Validated: 4EBP1 Antibody [NB200-157] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and 4EBP1 knockout (KO) HeLa cell line. PVDF membrane was probed with 0.5 ug/ml of Rabbit Anti-Human 4EBP1 Polyclonal Antibody (Catalog # NB200-157) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for 4EBP1 at approximately 17-20 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: 4EBP1 Antibody [NB200-157] - Whole cell lysate (100 ug) from RINm5F insulinoma exposed to high or low concentration of leucine. Antibody used at 0.25 ug/ml.
Immunohistochemistry: 4EBP1 Antibody [NB200-157] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti-4EBP1 used at a dilution of 1:20,000 ( 0.05ug/ml). Detection: DAB staining using Immunohistochemistry Accessory Kit.
(45 Publications)
Species: Hu
Applications: WB, IHC, IHC-P, KO
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Ribosomal Protein
S6/RPS6 Antibody
NB100-1595
Western Blot: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Detection of human and mouse RPS6 by western blot. Samples: Whole cell lysate (50 ug) from HeLa, HEK293T, Jurkat, mouse TCMK-1, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-RPS6 antibody NB100-1595 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.Previous
Immunohistochemistry-Paraffin: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Section of human lung carcinoma. Antibody: Affinity purified rabbit anti-RPS6 (NB100-1595). Detection: DAB
Immunoprecipitation: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Detection of human RPS6 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-RPS6 antibody NB100-1595 (lot NB100-1595-2) used for IP at 6 ug per reaction. RPS6 was also immunoprecipitated by a previous lot of this antibody (lot NB100-1595-1). For blotting immunoprecipitated RPS6, NB100-1595 was used at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
PYK2/FAK2 Antibody
(SC06-15)
NBP2-67627
Western Blot: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Analysis of PYK2 on mouse brain lysates using anti-PYK2 antibody at 1:1000 dilution.
Immunocytochemistry/Immunofluorescence: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Staining PYK2 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilized with 0.25% Triton X-100/PBS.
Immunohistochemistry-Paraffin: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Analysis of paraffin-embedded mouse kidney tissue using anti-PYK2 antibody. Counter stained with hematoxylin.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Tbp7 Antibody
NBP1-87799
Western Blot: Tbp7 Antibody [NBP1-87799] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunocytochemistry/Immunofluorescence: Tbp7 Antibody [NBP1-87799] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Tbp7 Antibody [NBP1-87799] - Staining of human gall bladder shows nuclear positivity in glandular cells.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
14-3-3 Antibody
NBP2-27202
Western Blot: 14-3-3 Antibody [NBP2-27202] - analysis of 14-3-3 using 14-3-3 antibody. Human Brain tissue lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse brain, and 4) rat brain lysate probed with 2 ug/ml of 14-3-3 antibody. I goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunocytochemistry/Immunofluorescence: 14-3-3 Antibody [NBP2-27202] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-14-3-3 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Simple Western: 14-3-3 Antibody [NBP2-27202] - Simple Western lane view shows a specific band for 14-3-3 Gamma in 0.5 mg/ml of Human Brain lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(1 Review)
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Ma-Op, Pm
Applications: WB, Simple Western, ICC/IF
TSC2 Antibody
(614204) [Unconjugate
MAB40401
Western blot shows lysates of HEK293 human embryonic kidney cell line, HeLa human cervical epithelial carcinoma cell line, Daudi human Burkitt's lymphoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse TSC2 Monoclonal Antibody (Catalog # MAB40401) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for TSC2 at approximately 200 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
TSC2 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Mouse Anti-Human/Mouse TSC2 Monoclonal Antibody (Catalog # MAB40401) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
TSC2 was detected in immersion fixed paraffin-embedded sections of human kidney using Mouse Anti-Human/Mouse TSC2 Monoclonal Antibody (Catalog # MAB40401) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to epithelial cell cytoplasm in convoluted tubules. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu, Mu
Applications: WB, IHC, ICC
PIK3CA Antibody
NBP2-19804
Western Blot: PIK3CA Antibody [NBP2-19804] - Various whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with PI3 kinase p110 alpha antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: PIK3CA Antibody [NBP2-19804] - HCT 116 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: PI3 kinase p110 alpha protein stained by PI3 kinase p110 alpha antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: PIK3CA Antibody [NBP2-19804] - PIK3CA Antibody Immunohistochemical analysis of paraffin-embedded Human Breast Cancer, using PI3 kinase p110 alpha antibody.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
TORC1 Antibody
NBP1-89865
Western Blot: TORC1 Antibody [NBP1-89865] - Analysis in human cell line BEWO.
Immunocytochemistry/Immunofluorescence: TORC1 Antibody [NBP1-89865] - Staining of human cell line A-431 shows localization to nucleoplasm, nuclear bodies, plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TORC1 Antibody [NBP1-89865] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferous ducts.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
p70 S6 Kinase/S6K
[p Thr389/412] Antibo ...
NB600-1049
Western Blot: p70 S6 Kinase/S6K [p Thr389/412] Antibody [NB600-1049] - Abeta facilitates HIF1alpha synthesis and autophagy inhibition via mTOR activation. Cells were incubated with rapamycin (10 nM) for 30 min prior to Abeta treatment for 24 h. Phosphorylation of 4EBP1 (Thr 37/46) and 4EBP1, phosphorylation of p70S6K1 (Thr 389), HIF1alpha and beta-actin were analyzed by western blot. n = 6. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fnmol.2017.00229/full) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: p70 S6 Kinase/S6K [p Thr389/412] Antibody [NB600-1049] - Analysis of Phospho-p70 S6 Kinase in 293 cells.
Immunohistochemistry: p70 S6 Kinase/S6K [p Thr389/412] Antibody [NB600-1049] - Human liver cancer tissue sections
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PI 3-Kinase p110
beta/PIK3CB Antibody ...
NBP2-88937
Western Blot: PI 3-Kinase p110 beta/PIK3CB Antibody (CL9518) [NBP2-88937] - Analysis in human cell line HEL.
Immunocytochemistry/Immunofluorescence: PI 3-Kinase p110 beta/PIK3CB Antibody (CL9518) [NBP2-88937] - Staining of A-431 cells using the Anti-PIK3CB monoclonal antibody, showing specific staining in the nucleoplasm and cytosol in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Immunohistochemistry-Paraffin: PI 3-Kinase p110 beta/PIK3CB Antibody (CL9518) [NBP2-88937] - Staining of human thyroid gland shows strong nuclear positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot: PI 3-Kinase p110 gamma Antibody [NBP2-15071] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with PI3 kinase p110 gamma antibody [C3], C-term diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: PI 3-Kinase p110 gamma Antibody [NBP2-15071] - Human Breast Cancer, using PI3K gamma antibody. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min
Western Blot: PI 3-Kinase p110 gamma Antibody [NBP2-15071] - Whole cell extract (30ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with PI3 kinase p110 gamma antibody [C3], C-term diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
PI 3-Kinase p110
delta Antibody (OTI1D ...
NBP2-46404
Immunohistochemistry: PI 3-Kinase p110 delta Antibody (1D11) [NBP2-46404] - Analysis of Carcinoma of Human prostate tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: PI 3-Kinase p110 delta Antibody (1D11) [NBP2-46404] - Analysis of Human breast tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: PI 3-Kinase p110 delta Antibody (1D11) [NBP2-46404] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Species: Hu
Applications: IHC, IHC-P
PTEN Antibody
[Unconjugated]
AF847
Western blot shows lysates of mouse and rat brain tissue, A431 human epithelial carcinoma cell line, and MRC-5 human embryonic lung fibroblast cell line. PVDF membrane was probed with 0.1 µg/mL Rabbit Anti-Human/Mouse/Rat PTEN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF847) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). For additional reference, recombinant human PTEN (5 ng) was included. A specific band for PTEN was detected at approximately 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
Simple Western lane view shows lysates of A431 human epithelial carcinoma cell line and HeLa human cervical epithelial carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for PTEN at approximately 60 kDa (as indicated) using 1 µg/mL of Rabbit Anti-Human/Mouse/Rat PTEN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF847). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and PTEN knockout HeLa cell line (KO). PVDF membrane was probed with 0.1 µg/mL of Rabbit Anti-Human/Mouse/Rat PTEN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF847) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for PTEN at approximately 55 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockoutHeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow, KO
Rheb Antibody
(JG37-12)
NBP2-75646
Western Blot: Rheb Antibody (JG37-12) [NBP2-75646] - Analysis of RHEB on mouse placenta tissue lysate using anti-RHEB antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: Rheb Antibody (JG37-12) [NBP2-75646] - Staining RHEB in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Rheb Antibody (JG37-12) [NBP2-75646] - Analysis of paraffin-embedded human fetal skeletal muscle tissue using anti-RHEB antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for PRAS40 Antibody (NBP2-57165) (0)

There are no publications for PRAS40 Antibody (NBP2-57165).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRAS40 Antibody (NBP2-57165) (0)

There are no reviews for PRAS40 Antibody (NBP2-57165). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PRAS40 Antibody (NBP2-57165) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional PRAS40 Products

Bioinformatics Tool for PRAS40 Antibody (NBP2-57165)

Discover related pathways, diseases and genes to PRAS40 Antibody (NBP2-57165). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRAS40 Antibody (NBP2-57165)

Discover more about diseases related to PRAS40 Antibody (NBP2-57165).
 

Pathways for PRAS40 Antibody (NBP2-57165)

View related products by pathway.

PTMs for PRAS40 Antibody (NBP2-57165)

Learn more about PTMs related to PRAS40 Antibody (NBP2-57165).
 

Research Areas for PRAS40 Antibody (NBP2-57165)

Find related products by research area.

Blogs on PRAS40.

Check out the latest blog posts on PRAS40.
Mapping Signal Transduction with mTOR Antibodies
The protein encoded by mTOR (mammalian target of rapamycin), also known as dTOR in Drosophila, belongs to a family of phosphatidylinositol kinase-related kinases. These kinases regulate fundamental processes of cell growth, proliferation, metabolism...  Read full blog post.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRAS40 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol AKT1S1