PRAS40 Antibody


Immunocytochemistry/ Immunofluorescence: PRAS40 Antibody [NBP2-54956] - Staining of human cell line HEK 293 shows localization to cytosol. Antibody staining is shown in green.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

PRAS40 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRK
Specificity of human PRAS40 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PRAS40 Recombinant Protein Antigen (NBP2-54956PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for PRAS40 Antibody

  • 40 kDa
  • AKT1 substrate 1 (proline-rich)
  • AKT1S1
  • Lobe
  • MGC2865
  • PRAS40
  • proline-rich AKT1 substrate 1,40 kDa proline-rich AKT substrate


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P, KO
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for PRAS40 Antibody (NBP2-54956) (0)

There are no publications for PRAS40 Antibody (NBP2-54956).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRAS40 Antibody (NBP2-54956) (0)

There are no reviews for PRAS40 Antibody (NBP2-54956). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PRAS40 Antibody (NBP2-54956) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PRAS40 Antibody (NBP2-54956)

Discover related pathways, diseases and genes to PRAS40 Antibody (NBP2-54956). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRAS40 Antibody (NBP2-54956)

Discover more about diseases related to PRAS40 Antibody (NBP2-54956).

Pathways for PRAS40 Antibody (NBP2-54956)

View related products by pathway.

PTMs for PRAS40 Antibody (NBP2-54956)

Learn more about PTMs related to PRAS40 Antibody (NBP2-54956).

Research Areas for PRAS40 Antibody (NBP2-54956)

Find related products by research area.

Blogs on PRAS40.

Mapping Signal Transduction with mTOR Antibodies
The protein encoded by mTOR (mammalian target of rapamycin), also known as dTOR in Drosophila, belongs to a family of phosphatidylinositol kinase-related kinases. These kinases regulate fundamental processes of cell growth, proliferation, metabolism...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PRAS40 Antibody and receive a gift card or discount.


Gene Symbol AKT1S1