PRAME Antibody (CL5146)

Images

 
Western Blot: PRAME Antibody (CL5146) [NBP2-61148] - Analysis in human cell line U-2 OS.
Immunocytochemistry/ Immunofluorescence: PRAME Antibody (CL5146) [NBP2-61148] - Staining of U-2 OS cells using the Anti-PRAME monoclonal antibody, showing specific staining in the nucleus and cytosol in green. ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clone
CL5146
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PRAME Antibody (CL5146) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGI
Epitope
VMNPLETLS
Specificity
Specificity of human PRAME antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG2a
Clonality
Monoclonal
Host
Mouse
Gene
PRAME
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
Application Notes
ICC/IF ixation/Permeabilization: PFA/Triton X-100
Control Peptide
PRAME Recombinant Protein Antigen (NBP2-61148PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for PRAME Antibody (CL5146)

  • cancer/testis antigen 130
  • MAPEOIP4CT130
  • melanoma antigen preferentially expressed in tumors
  • OIP-4
  • Opa-interacting protein 4
  • Opa-interacting protein OIP4
  • preferentially expressed antigen in melanoma
  • Preferentially expressed antigen of melanoma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76538
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-47714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-60011
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-75477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-25966
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30151
Species: Hu, Mu, Ca
Applications: ICC/IF, IHC, IHC-P
NB100-64775
Species: Hu, Mu, Pm, Bv, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, CyTOF-ready, IHC-P (-)
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NB100-417
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr, Dual ISH-IHC, KO
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-49659
Species: Hu
Applications: IHC, IHC-P
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, Gp, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Dual ISH-IHC, KD
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-67484
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00006275-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, S-ELISA

Publications for PRAME Antibody (NBP2-61148) (0)

There are no publications for PRAME Antibody (NBP2-61148).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRAME Antibody (NBP2-61148) (0)

There are no reviews for PRAME Antibody (NBP2-61148). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PRAME Antibody (NBP2-61148) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PRAME Products

Bioinformatics Tool for PRAME Antibody (NBP2-61148)

Discover related pathways, diseases and genes to PRAME Antibody (NBP2-61148). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRAME Antibody (NBP2-61148)

Discover more about diseases related to PRAME Antibody (NBP2-61148).
 

Pathways for PRAME Antibody (NBP2-61148)

View related products by pathway.

PTMs for PRAME Antibody (NBP2-61148)

Learn more about PTMs related to PRAME Antibody (NBP2-61148).
 

Research Areas for PRAME Antibody (NBP2-61148)

Find related products by research area.

Blogs on PRAME

There are no specific blogs for PRAME, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRAME Antibody (CL5146) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRAME