PPP3CB Antibody (5D3) - Azide and BSA Free

Western Blot: PPP3CB Antibody (5D3) [H00005532-M01] - Analysis of PPP3CB expression in transfected 293T cell line by PPP3CB monoclonal antibody (M01), clone 5D3.Lane 1: PPP3CB transfected lysate(59.1 KDa).Lane 2: Non-transfected lysate.

Western Blot: PPP3CB Antibody (5D3) [H00005532-M01] - Analysis of PPP3CB over-expressed 293 cell line, cotransfected with PPP3CB Validated Chimera RNAi ( Cat # H00005532-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PPP3CB monoclonal antibody (M01), clone 5D3 (Cat # H00005532-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Sandwich ELISA: PPP3CB Antibody (5D3) [H00005532-M01] - Detection limit for recombinant GST tagged PPP3CB is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, KD
• Clone: 5D3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PPP3CB Antibody (5D3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PPP3CB (NP_066955, 435 a.a. ~ 524 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
• Specificity: PPP3CB - protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform (calcineurin A beta)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PPP3CB
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPP3CB Antibody (5D3) - Azide and BSA Free

• Calmodulin-dependent calcineurin A subunit beta isoform
• CALNA2
• CALNA2protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform(calcineurin A beta)
• CALNB
• CAM-PRP catalytic subunit
• CNA beta
• CNA2
• CNA2catalytic subunit, beta isoform
• EC 3.1.3.16
• PPP3CB
• protein phosphatase 2B, catalytic subunit, beta isoform
• protein phosphatase 3, catalytic subunit, beta isozyme
• protein phosphatase from PCR fragment H32
• serine/threonine-protein phosphatase 2B catalytic subunit beta isoform

Background

Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP3CB
• Entrez:
  • 5532(Human)
• OMIM:
  • 114106(Human)
• Uniprot:
  • NP_066955(Human)