PPP3CB Antibody (5D3)

Images

 
Western Blot: PPP3CB Antibody (5D3) [H00005532-M01] - Analysis of PPP3CB expression in transfected 293T cell line by PPP3CB monoclonal antibody (M01), clone 5D3.Lane 1: PPP3CB transfected lysate(59.1 KDa).Lane 2: ...read more
Western Blot: PPP3CB Antibody (5D3) [H00005532-M01] - Analysis of PPP3CB over-expressed 293 cell line, cotransfected with PPP3CB Validated Chimera RNAi ( Cat # H00005532-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Sandwich ELISA: PPP3CB Antibody (5D3) [H00005532-M01] - Detection limit for recombinant GST tagged PPP3CB is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA, KD
Clone
5D3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PPP3CB Antibody (5D3) Summary

Immunogen
PPP3CB (NP_066955, 435 a.a. ~ 524 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
Specificity
PPP3CB - protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform (calcineurin A beta)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PPP3CB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPP3CB Antibody (5D3)

  • Calmodulin-dependent calcineurin A subunit beta isoform
  • CALNA2
  • CALNA2protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform(calcineurin A beta)
  • CALNB
  • CAM-PRP catalytic subunit
  • CNA beta
  • CNA2
  • CNA2catalytic subunit, beta isoform
  • EC 3.1.3.16
  • PPP3CB
  • protein phosphatase 2B, catalytic subunit, beta isoform
  • protein phosphatase 3, catalytic subunit, beta isozyme
  • protein phosphatase from PCR fragment H32
  • serine/threonine-protein phosphatase 2B catalytic subunit beta isoform

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88218
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1348
Species: Hu, Mu, Rt
Applications: Simple Western, WB
202-IL
Species: Hu
Applications: BA
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-98389
Species: Mu
Applications: WB
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB
DY871
Species: Hu
Applications: ELISA
NBP1-47470
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-32691
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP1-86656
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NB100-56732
Species: Hu, Mu
Applications: ICC/IF, IHC, Simple Western, WB
NBP2-93211
Species: Hu, Mu, Rt
Applications: WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB

Publications for PPP3CB Antibody (H00005532-M01) (0)

There are no publications for PPP3CB Antibody (H00005532-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP3CB Antibody (H00005532-M01) (0)

There are no reviews for PPP3CB Antibody (H00005532-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP3CB Antibody (H00005532-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP3CB Products

Bioinformatics Tool for PPP3CB Antibody (H00005532-M01)

Discover related pathways, diseases and genes to PPP3CB Antibody (H00005532-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP3CB Antibody (H00005532-M01)

Discover more about diseases related to PPP3CB Antibody (H00005532-M01).
 

Pathways for PPP3CB Antibody (H00005532-M01)

View related products by pathway.

PTMs for PPP3CB Antibody (H00005532-M01)

Learn more about PTMs related to PPP3CB Antibody (H00005532-M01).
 

Research Areas for PPP3CB Antibody (H00005532-M01)

Find related products by research area.

Blogs on PPP3CB

There are no specific blogs for PPP3CB, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP3CB Antibody (5D3) and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP3CB
Entrez
OMIM
Uniprot