Recombinant Human PPP2R5E Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PPP2R5E Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 47 - 145 of Human PPP2R5E partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVSCNIFRTLPPSDSNEFDPEEDEPTLE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PPP2R5E

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PPP2R5E Protein

  • epsilon isoform of regulatory subunit B56, protein phosphatase 2A
  • PP2A B subunit isoform B56-epsilon
  • PP2A B subunit isoform B'-epsilon
  • PP2A B subunit isoform PR61-epsilon
  • PP2A B subunit isoform R5-epsilon
  • PP2A, B subunit, B' epsilon
  • PP2A, B subunit, B56 epsilon
  • PP2A, B subunit, PR61 epsilon
  • PP2A, B subunit, R5 epsilon
  • protein phosphatase 2, regulatory subunit B (B56), epsilon isoform
  • protein phosphatase 2, regulatory subunit B', epsilon isoform
  • serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, epsilon
  • serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilonisoform

Background

PPP2R5E - protein phosphatase 2, regulatory subunit B (B56), epsilon isoform

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-32394
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
H00029127-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-1704
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56646
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-46134
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-47559
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP2-17299
Species: Hu
Applications: WB, ICC/IF
NBP1-89326
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15581
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P
H00005529-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PPP2R5E Partial Recombinant Protein (H00005529-Q01) (0)

There are no publications for PPP2R5E Partial Recombinant Protein (H00005529-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2R5E Partial Recombinant Protein (H00005529-Q01) (0)

There are no reviews for PPP2R5E Partial Recombinant Protein (H00005529-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP2R5E Partial Recombinant Protein (H00005529-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPP2R5E Products

Bioinformatics Tool for PPP2R5E Partial Recombinant Protein (H00005529-Q01)

Discover related pathways, diseases and genes to PPP2R5E Partial Recombinant Protein (H00005529-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP2R5E Partial Recombinant Protein (H00005529-Q01)

Discover more about diseases related to PPP2R5E Partial Recombinant Protein (H00005529-Q01).
 

Pathways for PPP2R5E Partial Recombinant Protein (H00005529-Q01)

View related products by pathway.

PTMs for PPP2R5E Partial Recombinant Protein (H00005529-Q01)

Learn more about PTMs related to PPP2R5E Partial Recombinant Protein (H00005529-Q01).
 

Research Areas for PPP2R5E Partial Recombinant Protein (H00005529-Q01)

Find related products by research area.

Blogs on PPP2R5E

There are no specific blogs for PPP2R5E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PPP2R5E Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R5E