PPP1R15B Antibody

Western Blot: PPP1R15B Antibody [NBP1-74269] - THP-1 Cell Lysate 1ug/ml Gel Concentration 12%

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PPP1R15B Antibody Summary

• Immunogen: Synthetic peptides corresponding to the C terminal of PPP1R15B. Immunizing peptide sequence SFCSVDPYNPQNFTATIQTAARIVPEEPSDSEKDLSGKSDLENSSQSGSL. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: 15B.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP1R15B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against PPP1R15B and was validated on Western blot.
• Theoretical MW: 79 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PPP1R15B Antibody

• CREP
• FLJ14744
• PPP1R15B
• protein phosphatase 1 regulatory subunit 15B
• protein phosphatase 1, regulatory (inhibitor) subunit 15B

Background

PPP1R15B promotes dephosphorylation of the transcription initiation factor EIF2-alpha through recruitment of protein phosphatase-1 (PP1) catalytic subunits.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP1R15B
• Uniprot:
  • Q5SWA1(Human)