PPM1E Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: EVEGESLDLCLQQLYKYNCPSFLAAALARATSDEVLQSDLSAHYIPKETDGTEGTVEIETVKLARSVFSKLHEI |
| Predicted Species |
Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PPM1E |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PPM1E Antibody - BSA Free
Background
The protein encoded by the PPM1E gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase was identified as an interacting protein of Rho guanine nucleotide exchange factors (PIX). PIX proteins are regulators of p21/Cdc42/Rac1-activated kinase 1 (PAK1), a protein kinase mediating biological effects downstream of Rho GTPases. This phosphatase has been shown to block the effects of PAK, and thus inhibit actin stress fiber breakdown and morphological changes driven by cell division cycle 42 (CDC42). (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Ca, Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Rt
Applications: WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Publications for PPM1E Antibody (NBP1-86649) (0)
There are no publications for PPM1E Antibody (NBP1-86649).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PPM1E Antibody (NBP1-86649) (0)
There are no reviews for PPM1E Antibody (NBP1-86649).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PPM1E Antibody (NBP1-86649) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PPM1E Products
Research Areas for PPM1E Antibody (NBP1-86649)
Find related products by research area.
|
Blogs on PPM1E