PPM1E Antibody (2L7W0)

Western Blot: PPM1E Antibody (2L7W0) [NBP3-33546] - Western blot analysis of various lysates using at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2L7W0
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PPM1E Antibody (2L7W0) Summary

• Description: Novus Biologicals Rabbit PPM1E Antibody (2L7W0) (NBP3-33546) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human PPM1E (Q8WY54).
  
  Sequence:
  ESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTDRTSLSPGSQINVLEDPGYLDLTQIEASKPHSAQFLLPVEMFGPGAPKKA
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PPM1E
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 84 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PPM1E Antibody (2L7W0)

• ca(2+)/calmodulin-dependent protein kinase phosphatase N
• CAMKN
• CaMKP-N
• caMKP-nucleus
• DKFZp781F1422
• KIAA1072
• nuclear calmodulin-dependent protein kinase phosphatase
• partner of PIX 1
• partner of PIXA
• partner of PIX-alpha
• POPX1
• PP2CH
• protein phosphatase 1E (PP2C domain containing)
• protein phosphatase 1E
• protein phosphatase, Mg2+/Mn2+ dependent, 1E

Background

The protein encoded by the PPM1E gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase was identified as an interacting protein of Rho guanine nucleotide exchange factors (PIX). PIX proteins are regulators of p21/Cdc42/Rac1-activated kinase 1 (PAK1), a protein kinase mediating biological effects downstream of Rho GTPases. This phosphatase has been shown to block the effects of PAK, and thus inhibit actin stress fiber breakdown and morphological changes driven by cell division cycle 42 (CDC42). (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPM1E