PPEF1 Antibody - BSA Free

Immunohistochemistry-Paraffin: PPEF1 Antibody [NBP1-87239] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PPEF1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PPEF1 Antibody - BSA Free (NBP1-87239) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWEQIIDILWSDP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPEF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PPEF1 Recombinant Protein Antigen (NBP1-87239PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PPEF1 Antibody - BSA Free

• EC 3.1.3.16
• PP7
• PPEF
• PPEF-1
• PPP7C
• PPP7CA
• protein phosphatase 7, catalytic subunit, alpha isozyme
• Protein phosphatase with EF calcium-binding domain
• protein phosphatase, EF-hand calcium binding domain 1
• protein phosphatase, serine/threonine type, with EF-hands
• serine/threonine protein phosphatase 7
• Serine/threonine-protein phosphatase 7
• serine/threonine-protein phosphatase with EF-hands 1

Background

PPEF1 encodes a member of the serine/threonine protein phosphatase with EF-hand motif family. The protein contains a protein phosphatase catalytic domain, and at least two EF-hand calcium-binding motifs in its C terminus. Although its substrate(s) is unknown, the encoded protein has been suggested to play a role in specific sensory neuron function and/or development. This gene shares high sequence similarity with the Drosophila retinal degeneration C (rdgC) gene. Several alternatively spliced transcript variants, each encoding a distinct isoform, have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPEF1