PP2C epsilon/PPM1L Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PP2C epsilon/PPM1L Antibody [NBP1-87247] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.

Immunohistochemistry-Paraffin: PP2C epsilon/PPM1L Antibody [NBP1-87247] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PP2C epsilon/PPM1L Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSK
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPM1L
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PP2C epsilon/PPM1L Protein (NBP1-87247PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PP2C epsilon/PPM1L Antibody - BSA Free

• EC 3.1.3
• EC 3.1.3.16
• MGC132545
• MGC132547
• PP2C epsilon
• PP2CE
• PP2CEProtein phosphatase 2C isoform epsilon
• PP2C-epsilon
• PPM1L
• PPM1-LIKE
• protein phosphatase 1 (formerly 2C)-like
• protein phosphatase 1L
• Protein phosphatase 1-like
• Protein phosphatase 2C epsilon isoform
• protein phosphatase, Mg2+/Mn2+ dependent, 1L

Background

PPM1L, or PP2CE, belongs to the PP2C group of serine/threonine phosphatases, which are distinguished from other phosphatases by their structure, absolute requirement for Mg(2+) or Mn(2+), and insensitivity to okadaic acid. PP2Cs regulate stress-activated protein kinase (SAPK; see MIM 601158) signaling cascades that respond to extracellular stimuli (Jin et al., 2004 [PubMed 15560375]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPM1L