PP2C epsilon/PPM1L Antibody


Western Blot: PP2C epsilon/PPM1L Antibody [NBP1-87247] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunocytochemistry/ Immunofluorescence: PP2C epsilon/PPM1L Antibody [NBP1-87247] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: PP2C epsilon/PPM1L Antibody [NBP1-87247] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

PP2C epsilon/PPM1L Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:DLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSK
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PP2C epsilon/PPM1L Protein (NBP1-87247PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PP2C epsilon/PPM1L Antibody

  • EC 3.1.3
  • EC
  • MGC132545
  • MGC132547
  • PP2C epsilon
  • PP2CE
  • PP2CEProtein phosphatase 2C isoform epsilon
  • PP2C-epsilon
  • PPM1L
  • protein phosphatase 1 (formerly 2C)-like
  • protein phosphatase 1L
  • Protein phosphatase 1-like
  • Protein phosphatase 2C epsilon isoform
  • protein phosphatase, Mg2+/Mn2+ dependent, 1L


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, RNAi
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PP2C epsilon/PPM1L Antibody (NBP1-87247) (0)

There are no publications for PP2C epsilon/PPM1L Antibody (NBP1-87247).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PP2C epsilon/PPM1L Antibody (NBP1-87247) (0)

There are no reviews for PP2C epsilon/PPM1L Antibody (NBP1-87247). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PP2C epsilon/PPM1L Antibody (NBP1-87247) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PP2C epsilon/PPM1L Products

Bioinformatics Tool for PP2C epsilon/PPM1L Antibody (NBP1-87247)

Discover related pathways, diseases and genes to PP2C epsilon/PPM1L Antibody (NBP1-87247). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PP2C epsilon/PPM1L Antibody (NBP1-87247)

Discover more about diseases related to PP2C epsilon/PPM1L Antibody (NBP1-87247).

Pathways for PP2C epsilon/PPM1L Antibody (NBP1-87247)

View related products by pathway.

Research Areas for PP2C epsilon/PPM1L Antibody (NBP1-87247)

Find related products by research area.

Blogs on PP2C epsilon/PPM1L

There are no specific blogs for PP2C epsilon/PPM1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PP2C epsilon/PPM1L Antibody and receive a gift card or discount.


Gene Symbol PPM1L