PP14/Glycodelin Antibody

Western Blot: PP14/Glycodelin Antibody [H00005047-D01P] - Analysis of PAEP expression in human placenta.

Western Blot: PP14/Glycodelin Antibody [H00005047-D01P] - Analysis of PAEP expression in transfected 293T cell line by PAEP polyclonal antibody.Lane 1: PAEP transfected lysate(20.60 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

PP14/Glycodelin Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: PAEP (NP_002562.2, 1 a.a. - 180 a.a.) full-length human protein. MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
• Specificity: PAEP - progestagen-associated endometrial protein (placental protein 14, pregnancy-associated endometrial alpha-2-globulin, alpha uterine protein),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAEP
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PP14/Glycodelin Antibody

• alpha uterine protein
• GdF
• GdS
• Glycodelin
• glycodelin-A
• glycodelin-F
• glycodelin-S
• MGC138509
• MGC142288
• PAEP
• PEP
• Placental protein 14
• PP14 protein (placental protein 14)
• PP14
• PP14GDPAEGGdA
• pregnancy-associated endometrial a
• Pregnancy-associated endometrial alpha-2 globulin
• pregnancy-associated endometrial alpha-2-globulin
• progestagen-associated endometrial protein (placental protein 14
• progestagen-associated endometrial proteinPEG
• Progesterone-associated endometrial protein

Background

This gene is a member of the kernel lipocalin superfamily whose members share relatively low sequence similarity but have highly conserved exon/intron structure and three-dimensional protein folding. Most lipocalins are clustered on the long arm of chromosome 9. The encoded glycoprotein has been previously referred to as pregnancy-associated endometrial alpha-2-globulin, placental protein 14, and glycodelin, but has been officially named progestagen-associated endometrial protein. Three distinct forms, with identical protein backbones but different glycosylation profiles, are found in amniotic fluid, follicular fluid and seminal plasma of the reproductive system. These glycoproteins have distinct and essential roles in regulating a uterine environment suitable for pregnancy and in the timing and occurrence of the appropriate sequence of events in the fertilization process. A number of alternatively spliced transcript variants have been observed at this locus, but the full-length nature of only two, each encoding the same protein, has been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PAEP
• Entrez:
  • 5047(Human)
• Uniprot:
  • NP_002562.2(Human)