PP1 Inhibitor-2 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
The specific Immunogen is proprietary information. Peptide sequence ASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYH. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PPP1R2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for PP1 Inhibitor-2 Antibody - BSA Free
Background
Two inhibitors of protein phosphatase 1 (PP1) include the phosphatase inhibitor 1 (IPP-1) and phosphatase inhibitor 2 (IPP-2). IPP-2, also known as I-2, interacts with the catalytic subunit of PP1 to form the heterodimer PP1I. The PP1I complex is present in the cytosol of cells in a broad range of vertebrate and invertebrate species. Although the heterodimer itself is inactive, a reversible phosphorylation of IPP-2 at Thr 72 by glycogen-synthase-kinase (GSK3) initiates activation of the heterodimer complex in vitro. Phosphorylation of IPP-2 by casein kinase-II at Ser 86, Ser 120, and Ser 121 enhances the rate of phosphorylation by GSK3 at Thr 72 and effectively activates the heterodimer complex. Besides moderating PP1 activity, IPP-2 may play a role as a chaperone for the correct folding of PP1. The gene for human IPP-2 maps to chromosome 6 in the major histocompatiblity complex region.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Ca, Eq, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for PP1 Inhibitor-2 Antibody (NBP1-79889) (0)
There are no publications for PP1 Inhibitor-2 Antibody (NBP1-79889).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PP1 Inhibitor-2 Antibody (NBP1-79889) (0)
There are no reviews for PP1 Inhibitor-2 Antibody (NBP1-79889).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PP1 Inhibitor-2 Antibody (NBP1-79889) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PP1 Inhibitor-2 Products
Research Areas for PP1 Inhibitor-2 Antibody (NBP1-79889)
Find related products by research area.
|
Blogs on PP1 Inhibitor-2