POU3F2/OCT7 Antibody


Immunocytochemistry/ Immunofluorescence: POU3F2/OCT7 Antibody [NBP2-55453] - Staining of human cell line AF22 shows localization to nucleus.
Immunocytochemistry/ Immunofluorescence: POU3F2/OCT7 Antibody [NBP2-55453] - Staining of human cell line PC-3 shows localization to nucleus.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

POU3F2/OCT7 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHP
Specificity of human POU3F2/OCT7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
POU3F2/OCT7 Recombinant Protein Antigen (NBP2-55453PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for POU3F2/OCT7 Antibody

  • Brain-2
  • Brain-specific homeobox/POU domain protein 2
  • BRN2
  • brn-2
  • BRN2brain-2
  • Nervous system-specific octamer-binding transcription factor N-Oct-3
  • Oct7
  • oct-7
  • OCT7POU domain class 3, transcription factor 2
  • Octamer-binding protein 7
  • Octamer-binding transcription factor 7
  • OTF7
  • OTF-7
  • POU class 3 homeobox 2
  • POU domain, class 3, transcription factor 2
  • POU3F2
  • POUF3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, ELISA, IP
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, PEP-ELISA

Publications for POU3F2/OCT7 Antibody (NBP2-55453) (0)

There are no publications for POU3F2/OCT7 Antibody (NBP2-55453).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POU3F2/OCT7 Antibody (NBP2-55453) (0)

There are no reviews for POU3F2/OCT7 Antibody (NBP2-55453). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for POU3F2/OCT7 Antibody (NBP2-55453) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for POU3F2/OCT7 Antibody (NBP2-55453)

Discover related pathways, diseases and genes to POU3F2/OCT7 Antibody (NBP2-55453). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POU3F2/OCT7 Antibody (NBP2-55453)

Discover more about diseases related to POU3F2/OCT7 Antibody (NBP2-55453).

Pathways for POU3F2/OCT7 Antibody (NBP2-55453)

View related products by pathway.

PTMs for POU3F2/OCT7 Antibody (NBP2-55453)

Learn more about PTMs related to POU3F2/OCT7 Antibody (NBP2-55453).

Research Areas for POU3F2/OCT7 Antibody (NBP2-55453)

Find related products by research area.

Blogs on POU3F2/OCT7

There are no specific blogs for POU3F2/OCT7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our POU3F2/OCT7 Antibody and receive a gift card or discount.


Gene Symbol POU3F2