POP4 Antibody

Images

 
Western Blot: POP4 Antibody [NBP1-57218] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry-Paraffin: POP4 Antibody [NBP1-57218] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POP4 Antibody Summary

Immunogen
Synthetic peptides corresponding to POP4 (processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae)) The peptide sequence was selected from the C terminal of POP4. Peptide sequence EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAK
Specificity
This product is specific to Subunit or Isoform: p29.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POP4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against POP4 and was validated on Western Blot and immunohistochemistry-p

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for POP4 Antibody

  • EC 3.1.26.5
  • processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae)
  • ribonuclease P protein subunit p29
  • RPP29hPOP4

Background

POP4 is a part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. It may function with RPP38 to coordinate the nucleolar targeting and/or assembly of RNase P.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57072
Species: Hu, Mu
Applications: WB
H00079897-P01
Species: Hu
NBP2-68837
Species: Hu
Applications: ICC/IF
H00065108-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
NBP1-60052
Species: Hu
Applications: WB
NBP2-57299
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92282
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13260
Species: Hu
Applications: WB, ICC/IF, KD
NBP1-80658
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88765
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56076
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-83286
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00055599-P01
Species: Hu
AF6810
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-87466
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2635
Species: Hu
Applications: WB
NBP1-57218
Species: Hu
Applications: WB, IHC, IHC-P

Publications for POP4 Antibody (NBP1-57218) (0)

There are no publications for POP4 Antibody (NBP1-57218).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POP4 Antibody (NBP1-57218) (0)

There are no reviews for POP4 Antibody (NBP1-57218). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POP4 Antibody (NBP1-57218) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional POP4 Products

Bioinformatics Tool for POP4 Antibody (NBP1-57218)

Discover related pathways, diseases and genes to POP4 Antibody (NBP1-57218). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POP4 Antibody (NBP1-57218)

Discover more about diseases related to POP4 Antibody (NBP1-57218).
 

Pathways for POP4 Antibody (NBP1-57218)

View related products by pathway.

PTMs for POP4 Antibody (NBP1-57218)

Learn more about PTMs related to POP4 Antibody (NBP1-57218).

Blogs on POP4

There are no specific blogs for POP4, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POP4
Uniprot
COVID-19 update