PON3 Antibody

Images

 
Western Blot: PON3 Antibody [NBP1-69633] - This Anti-PON3 antibody was used in Western Blot of NCI-H226 tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: PON3 Antibody [NBP1-69633] - Liver tissue at an antibody concentration of 5 ug/ml using anti-PON3 antibody

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PON3 Antibody Summary

Immunogen
Synthetic peptides corresponding to PON3(paraoxonase 3) The peptide sequence was selected from the middle region of PON3. Peptide sequence PMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PON3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against PON3 and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PON3 Antibody

  • EC 3.1.1.2
  • EC 3.1.1.81
  • EC 3.1.8.1
  • paraoxanase-3
  • paraoxonase 3
  • PON3
  • serum paraoxonase/lactonase 3

Background

This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL). The protein also rapidly hydr

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-23610
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC
AF4344
Species: Hu
Applications: WB
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
AF1436
Species: Mu
Applications: WB
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB3446
Species: Hu
Applications: WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi

Publications for PON3 Antibody (NBP1-69633) (0)

There are no publications for PON3 Antibody (NBP1-69633).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PON3 Antibody (NBP1-69633) (0)

There are no reviews for PON3 Antibody (NBP1-69633). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PON3 Antibody (NBP1-69633) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PON3 Products

Bioinformatics Tool for PON3 Antibody (NBP1-69633)

Discover related pathways, diseases and genes to PON3 Antibody (NBP1-69633). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PON3 Antibody (NBP1-69633)

Discover more about diseases related to PON3 Antibody (NBP1-69633).
 

Pathways for PON3 Antibody (NBP1-69633)

View related products by pathway.

PTMs for PON3 Antibody (NBP1-69633)

Learn more about PTMs related to PON3 Antibody (NBP1-69633).

Blogs on PON3

There are no specific blogs for PON3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PON3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PON3
Entrez
Uniprot