PON3 Antibody


Western Blot: PON3 Antibody [NBP1-69633] - This Anti-PON3 antibody was used in Western Blot of NCI-H226 tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: PON3 Antibody [NBP1-69633] - Liver tissue at an antibody concentration of 5 ug/ml using anti-PON3 antibody

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC

Order Details

PON3 Antibody Summary

Synthetic peptides corresponding to PON3(paraoxonase 3) The peptide sequence was selected from the middle region of PON3. Peptide sequence PMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVY.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against PON3 and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PON3 Antibody

  • EC
  • EC
  • EC
  • paraoxanase-3
  • paraoxonase 3
  • PON3
  • serum paraoxonase/lactonase 3


This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL). The protein also rapidly hydr


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Dr
Applications: EM, PEP-ELISA

Publications for PON3 Antibody (NBP1-69633) (0)

There are no publications for PON3 Antibody (NBP1-69633).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PON3 Antibody (NBP1-69633) (0)

There are no reviews for PON3 Antibody (NBP1-69633). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PON3 Antibody (NBP1-69633) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PON3 Products

Bioinformatics Tool for PON3 Antibody (NBP1-69633)

Discover related pathways, diseases and genes to PON3 Antibody (NBP1-69633). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PON3 Antibody (NBP1-69633)

Discover more about diseases related to PON3 Antibody (NBP1-69633).

Pathways for PON3 Antibody (NBP1-69633)

View related products by pathway.

PTMs for PON3 Antibody (NBP1-69633)

Learn more about PTMs related to PON3 Antibody (NBP1-69633).

Blogs on PON3

There are no specific blogs for PON3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PON3 Antibody and receive a gift card or discount.


Gene Symbol PON3