POLR3K Antibody - Azide and BSA Free Summary
| Immunogen |
POLR3K (NP_057394.1, 1 a.a. - 108 a.a.) full-length human protein. MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
POLR3K |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is useful for Western Blot |
Reactivity Notes
This product is reactive against Human.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for POLR3K Antibody - Azide and BSA Free
Background
This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ELISA
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Publications for POLR3K Antibody (H00051728-D01P) (0)
There are no publications for POLR3K Antibody (H00051728-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for POLR3K Antibody (H00051728-D01P) (0)
There are no reviews for POLR3K Antibody (H00051728-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for POLR3K Antibody (H00051728-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional POLR3K Products
Research Areas for POLR3K Antibody (H00051728-D01P)
Find related products by research area.
|
Blogs on POLR3K