Recombinant Human POLR3B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human POLR3B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 2-100 of Human POLR3B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DVLAEEFGNLTPEQLAAPIPTVEEKWRLLPAFLKVKGLVKQHIDSFNYFINVEIKKIMKANEKVTSDADPMWYLKYLNIYVGLPDVEESFNVTRPVSPH

Protein/Peptide Type
Partial Recombinant Protein
Gene
POLR3B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human POLR3B Protein

  • C128
  • DKFZp686B10117
  • DNA-directed RNA polymerase III 127.6 kDa polypeptide
  • DNA-directed RNA polymerase III subunit B
  • DNA-directed RNA polymerase III subunit RPC2
  • EC 2.7.7.6
  • FLJ10388
  • polymerase (RNA) III (DNA directed) polypeptide B
  • RNA polymerase III subunit C2
  • RPC2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83204
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87113
Species: Hu, Mu, Rt, Dr
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-84621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49530
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-80815
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-53092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009533-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-47329
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-14254
Species: Hu, Mu
Applications: WB, IHC
NBP2-19885
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00482
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-80816
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00055703-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for POLR3B Partial Recombinant Protein (H00055703-Q01) (0)

There are no publications for POLR3B Partial Recombinant Protein (H00055703-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR3B Partial Recombinant Protein (H00055703-Q01) (0)

There are no reviews for POLR3B Partial Recombinant Protein (H00055703-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POLR3B Partial Recombinant Protein (H00055703-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POLR3B Products

Bioinformatics Tool for POLR3B Partial Recombinant Protein (H00055703-Q01)

Discover related pathways, diseases and genes to POLR3B Partial Recombinant Protein (H00055703-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLR3B Partial Recombinant Protein (H00055703-Q01)

Discover more about diseases related to POLR3B Partial Recombinant Protein (H00055703-Q01).
 

Pathways for POLR3B Partial Recombinant Protein (H00055703-Q01)

View related products by pathway.

PTMs for POLR3B Partial Recombinant Protein (H00055703-Q01)

Learn more about PTMs related to POLR3B Partial Recombinant Protein (H00055703-Q01).

Blogs on POLR3B

There are no specific blogs for POLR3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NuMA Antibody
NB500-174
POLR3B Antibody
NBP1-84628

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human POLR3B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR3B