POLR2E Antibody - Azide and BSA Free

Western Blot: POLR2E Antibody [H00005434-B01P] - Analysis of POLR2E expression in transfected 293T cell line by POLR2E polyclonal antibody. Lane 1: POLR2E transfected lysate(23.1 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

POLR2E Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: POLR2E (NP_002686.2, 1 a.a. - 210 a.a.) full-length human protein. MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ
• Specificity: POLR2E - polymerase (RNA) II (DNA directed) polypeptide E, 25kDa,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: POLR2E
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against transfected lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for POLR2E Antibody - Azide and BSA Free

• DNA directed RNA polymerase II 23 kda polypeptide
• DNA-directed RNA polymerase II 23 kDa polypeptide
• DNA-directed RNA polymerase II subunit E
• DNA-directed RNA polymerases I, II, and III subunit RPABC1
• hRPB25
• hsRPB5
• polymerase (RNA) II (DNA directed) polypeptide E (25kD)
• polymerase (RNA) II (DNA directed) polypeptide E, 25kDa
• RPABC1
• RPB5 homolog
• RPB5
• XAP4RNA polymerases I, II, and III subunit ABC1

Background

This gene encodes the fifth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases and is present in two-fold molar excess over the other polymerase subunits. An interaction between this subunit and a hepatitis virus transactivating protein has been demonstrated, suggesting that interaction between transcriptional activators and the polymerase can occur through this subunit. A pseudogene is located on chromosome 11. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POLR2E
• Entrez:
  • 5434(Human)
• Uniprot:
  • NP_002686.2(Human)