POLR1D Antibody

Images

 
Western Blot: POLR1D Antibody [H00051082-B01P] - Analysis of POLR1D expression in Jurkat.
Immunocytochemistry/ Immunofluorescence: POLR1D Antibody [H00051082-B01P] - Analysis of purified antibody to POLR1D on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: POLR1D Antibody [H00051082-B01P] - Analysis of POLR1D expression in transfected 293T cell line by POLR1D polyclonal antibody. Lane 1: POLR1D transfected lysate(14.63 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

POLR1D Antibody Summary

Immunogen
POLR1D (NP_057056.1, 1 a.a. - 133 a.a.) full-length human protein. MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
POLR1D
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Western Blot
Application Notes
This antibody is useful for Western Blot, Functional, Immunofluorescence

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for POLR1D Antibody

  • AC19
  • DNA-directed RNA polymerase I subunit D
  • DNA-directed RNA polymerases I and III subunit RPAC2
  • FLJ20616
  • hRPA19
  • MGC9850
  • POLR1C
  • polymerase (RNA) I polypeptide D, 16kDa
  • RPA16RNA polymerase I 16 kDa subunit
  • RPA9
  • RPAC2RNA polymerases I and III subunit AC2
  • RPC16
  • RPO1-3
  • TCS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80817
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93617
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-86908
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-53092
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP1-84628
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67698
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93863
Species: Mu, Rt
Applications: IHC, IHC-P
NBP1-86780
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-83204
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87113
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB300-268
Species: Bv, Ce, Hu, I, Mu, Pl
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00482
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-32716
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-80816
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB200-598
Species: Hu, Mu, Pm(-), Ye
Applications: ChIP, CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IP, WB
NBP2-58327
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for POLR1D Antibody (H00051082-B01P) (0)

There are no publications for POLR1D Antibody (H00051082-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR1D Antibody (H00051082-B01P) (0)

There are no reviews for POLR1D Antibody (H00051082-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for POLR1D Antibody (H00051082-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POLR1D Products

Bioinformatics Tool for POLR1D Antibody (H00051082-B01P)

Discover related pathways, diseases and genes to POLR1D Antibody (H00051082-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLR1D Antibody (H00051082-B01P)

Discover more about diseases related to POLR1D Antibody (H00051082-B01P).
 

Pathways for POLR1D Antibody (H00051082-B01P)

View related products by pathway.

Blogs on POLR1D

There are no specific blogs for POLR1D, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLR1D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR1D
Uniprot