PNPLA8 Antibody

Images

 
Western Blot: PNPLA8 Antibody [NBP1-83098] - Analysis in human cell line U-2197.
Immunocytochemistry/ Immunofluorescence: PNPLA8 Antibody [NBP1-83098] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PNPLA8 Antibody [NBP1-83098] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PNPLA8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNPLA8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PNPLA8 Protein (NBP1-83098PEP)
Publications
Read Publications using
NBP1-83098 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22237407)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PNPLA8 Antibody

  • calcium-independent phospholipase A2-gamma
  • EC 3.1.1.5
  • Intracellular membrane-associated calcium-independent phospholipase A2 gamma
  • iPLA2 gamma
  • IPLA22
  • IPLA2-2
  • iPLA2-gamma
  • IPLA2GIPLA2(GAMMA)
  • membrane-associated calcium-independent phospholipase A2 gamma
  • patatin-like phospholipase domain containing 8
  • Patatin-like phospholipase domain-containing protein 8
  • PNPLA-gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008398-D01P
Species: Hu, Mu
Applications: WB
MAB5018
Species: Hu
Applications: IP, WB
AF4925
Species: Mu
Applications: IHC, Simple Western, WB
AF5365
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
DRP300
Species: Hu
Applications: ELISA
NBP2-89114
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB6425
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-00735
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP2-24593
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
H00151056-B01P
Species: Hu, Mu
Applications: WB
AF009
Species: Hu
Applications: IHC, WB
NLS4198
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
NBP2-73621
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
NB600-533
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
NBP1-32791
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB

Publications for PNPLA8 Antibody (NBP1-83098)(3)

Reviews for PNPLA8 Antibody (NBP1-83098) (0)

There are no reviews for PNPLA8 Antibody (NBP1-83098). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PNPLA8 Antibody (NBP1-83098) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PNPLA8 Products

Bioinformatics Tool for PNPLA8 Antibody (NBP1-83098)

Discover related pathways, diseases and genes to PNPLA8 Antibody (NBP1-83098). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PNPLA8 Antibody (NBP1-83098)

Discover more about diseases related to PNPLA8 Antibody (NBP1-83098).
 

Pathways for PNPLA8 Antibody (NBP1-83098)

View related products by pathway.

Blogs on PNPLA8

There are no specific blogs for PNPLA8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PNPLA8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PNPLA8