Home » PNPLA8 » PNPLA8 Antibodies » PNPLA8 Antibody

PNPLA8 Antibody

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: PNPLA8 Antibody [NBP1-83098] - Analysis in human cell line U-2197.
Western Blot: PNPLA8 Antibody [NBP1-83098] - Analysis in human cell line U-2197.
Immunocytochemistry/ Immunofluorescence: PNPLA8 Antibody [NBP1-83098] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PNPLA8 Antibody [NBP1-83098] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PNPLA8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNPLA8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PNPLA8 Protein (NBP1-83098PEP)
Publications
Read Publications using
NBP1-83098 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22237407)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PNPLA8 Antibody

  • calcium-independent phospholipase A2-gamma
  • EC 3.1.1.5
  • Intracellular membrane-associated calcium-independent phospholipase A2 gamma
  • iPLA2 gamma
  • IPLA22
  • IPLA2-2
  • iPLA2-gamma
  • IPLA2GIPLA2(GAMMA)
  • membrane-associated calcium-independent phospholipase A2 gamma
  • patatin-like phospholipase domain containing 8
  • Patatin-like phospholipase domain-containing protein 8
  • PNPLA-gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PLA2G6 Antibody
H00008398-D01P
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in human kidney.
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in transfected 293T cell line by PLA2G6 polyclonal antibody.Lane 1: PLA2G6 transfected lysate(84.10 KDa).Lane 2: Non-transfected lysate.
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in mouse kidney.
Species: Hu, Mu
Applications: WB
PLA2G1B Antibody
(630823)
MAB5018
Western blot shows lysates of human pancreas tissue. PVDF Membrane was probed with 2 µg/mL of Human PLA2G1B Monoclonal Antibody (Catalog # MAB5018) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for PLA2G1B at approximately 17 kDa (as indicated). This experiment was conducted under non-reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: IP, WB
PLA2G2A Antibody
[Unconjugated]
AF4925
Western blot shows lysates of mouse small intestine tissue. PVDF Membrane was probed with 0.5 µg/mL of Sheep Anti-Mouse PLA2G2A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4925) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for PLA2G2A at approximately 17 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
PLA2G2A was detected in perfusion fixed frozen sections of mouse intestine using Sheep Anti-Mouse PLA2G2A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4925) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells in intestinal glands. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of mouse small intestine tissue, loaded at 0.2 mg/mL. A specific band was detected for PLA2G2A at approximately 27 kDa (as indicated) using 5 µg/mL of Sheep Anti-Mouse PLA2G2A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4925) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Species: Mu
Applications: IHC, Simple Western, WB
PEDFR/PNPLA2/ATGL
Antibody [Unconjugate ...
AF5365
Western blot shows lysates of human adipose tissue and mouse adipose tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat PEDF R/PNPLA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5365) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for PEDF R/PNPLA2 at approximately 55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Simple Western lane view shows lysates of mouse adipose tissue, loaded at 0.2 mg/mL. A specific band was detected for PEDF R/PNPLA2 at approximately 59 kDa (as indicated) using 10 µg/mL of Sheep Anti-Human/Mouse/Rat PEDF R/PNPLA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5365) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
PEDF R/PNPLA2 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Sheep Anti-Human/Mouse/Rat PEDF R/PNPLA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5365) overnight at 4 °C. Tissue was stained with the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific labeling was localized to the plasma membrane of epithelial cells in tubules. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Adiponectin/Acrp30
[HRP]
DRP300
(6 Reviews)
(146 Publications)
Species: Hu
Applications: ELISA
Acetyl-CoA
Carboxylase alpha/ACA ...
NBP2-89114
Immunocytochemistry/Immunofluorescence: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-89114] - Staining Acetyl CoA Carboxylase 1 (ACC1) in MCF-7 cells (green). Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with the antibody at a dilution of 1:100 for 1 hour at room temperature, washed with PBS. Alexa Fluor(TM) 488 Goat anti-Rabbit IgG was used as the secondary antibody at 1/100 dilution. The nuclear counter stain is DAPI (blue).
Immunocytochemistry/Immunofluorescence: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-89114] - Staining Acetyl CoA Carboxylase 1 (ACC1) in SiHa cells (green). Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with the antibody at a dilution of 1:200 for 1 hour at room temperature, washed with PBS. Alexa Fluor(TM) 488 Goat anti-Rabbit IgG was used as the secondary antibody at 1/100 dilution. The nuclear counter stain is DAPI (blue).
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-89114] - Analysis of paraffin-embedded rat skeletal muscle tissue using anti-Acetyl CoA Carboxylase 1 (ACC1) antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the antibody at 1/200 dilution, for 30 minutes at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chrogen. Counter stained with hematoxylin and mounted with DPX.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AE Binding Protein
1/ACLP Antibody (5908 ...
MAB6425
HASMC human human aortic smooth muscle cells was stained with Human ACLP Monoclonal Antibody (Catalog # MAB6425, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: CyTOF-ready, ICFlow
Monoglyceride
Lipase Antibody (OTI2
NBP2-00735
Western Blot: Monoglyceride Lipase Antibody (OTI2B11) [NBP2-00735] - Analysis of extracts (10ug) from HeLa cell line, dilution(1:200).
Immunocytochemistry/Immunofluorescence: Monoglyceride Lipase Antibody (OTI2B11) [NBP2-00735] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY.
Flow Cytometry: Monoglyceride Lipase Antibody (2B11) [NBP2-00735] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Monoglyceride Lipase antibody, and then analyzed by flow cytometry.
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TEF1 Antibody
NBP2-94035
Chromatin Immunoprecipitation: TEF1 Antibody [NBP2-94035] - Analysis of extracts of HeLa cell line, using TEF1 rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Immunocytochemistry/Immunofluorescence: TEF1 Antibody [NBP2-94035] - Analysis of MCF7 cells using TEF1 .
Chromatin Immunoprecipitation: TEF1 Antibody [NBP2-94035] - Analysis of extracts of HeLa cell line, using TEF1 rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
14-3-3 zeta
Antibody
NBP2-24593
Western Blot: 14-3-3 zeta Antibody [NBP2-24593] - analysis of 14-3-3 zeta in human brain lysate in the 1) absence, 2) presence of immunizing peptide, 3) mouse brain lysate and 4) rat brain lysate in the absence of immunizing peptide using this antibody. I goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: 14-3-3 zeta Antibody [NBP2-24593] - Formalin-fixed, paraffin-embedded human spleen stained with 14-3-3 zeta antibody at 10 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Phospholipase B1
Antibody
H00151056-B01P
Western Blot: Phospholipase B1 Antibody [H00151056-B01P] - Analysis of PLB1 expression in transfected 293T cell line by PLB1 polyclonal antibody. Lane 1: PLB1 transfected lysate(46.53 KDa). Lane 2: Non-transfected lysate.
(1 Publication)
Species: Hu, Mu
Applications: WB
Neurophysin
II/Arg-vasopressin An ...
AF009
Neurophysin II was detected in immersion fixed paraffin-embedded sections of human pituitary using Goat Anti-Human Neurophysin II Antigen Affinity-purified Polyclonal Antibody (Catalog # AF009) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell cytoplasm. Staining was performed using our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Species: Hu
Applications: IHC, WB
beta-3 Adrenergic
R/ADRB3 Antibody - BS ...
NLS4198
Immunohistochemistry-Paraffin: beta-3 Adrenergic R/ADRB3 Antibody [NLS4198] - Human small intestine tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: beta-3 Adrenergic R/ADRB3 Antibody [NLS4198] - Human prostate tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: beta-3 Adrenergic R/ADRB3 Antibody [NLS4198] - Analysis of beta-3 Adrenergic R/ADRB3 Antibody with adrenal tissue.
(2 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
beta-Actin
Antibody (AC-15)
NB600-501
Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - HEK293T cells transfected with Niaph virus Matrix Protein, expression 24h later. This image was submitted via customer review.
Simple Western: beta-Actin Antibody (AC-15) [NB600-501] - Analysis using the HRP conjugate of NB600-501. Image shows a specific band for Beta-Actin in 0.2 mg/mL of Hela, MCF-7, SH-SY5Y, & Jurkat lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
Simple Western: beta-Actin Antibody (AC-15) [NB600-501] - Analysis using the HRP conjugate of NB600-501. Electropherogram image(s) of corresponding Simple Western lane view. Beta-Actin antibody was used at 1:500 dilution on Hela, MCF-7, SH-SY5Y, & Jurkat lysate(s).
(27 Reviews)
(491 Publications)
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Proprotein
Convertase 7/PCSK7 An ...
NBP2-73621
Flow Cytometry: Proprotein Convertase 7/PCSK7 Antibody (OTI1B8) - Azide and BSA Free [NBP2-73621] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostaining by anti-PCSK7 antibody, and then analyzed by flow cytometry.
Immunocytochemistry/Immunofluorescence: Proprotein Convertase 7/PCSK7 Antibody (OTI1B8) - Azide and BSA Free [NBP2-73621] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY PCSK7.
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF
beta-Actin
Antibody (AC-15)
NB600-501
Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - HEK293T cells transfected with Niaph virus Matrix Protein, expression 24h later. This image was submitted via customer review.
Simple Western: beta-Actin Antibody (AC-15) [NB600-501] - Analysis using the HRP conjugate of NB600-501. Image shows a specific band for Beta-Actin in 0.2 mg/mL of Hela, MCF-7, SH-SY5Y, & Jurkat lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
Simple Western: beta-Actin Antibody (AC-15) [NB600-501] - Analysis using the HRP conjugate of NB600-501. Electropherogram image(s) of corresponding Simple Western lane view. Beta-Actin antibody was used at 1:500 dilution on Hela, MCF-7, SH-SY5Y, & Jurkat lysate(s).
(27 Reviews)
(491 Publications)
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Actin Gamma 1
Antibody
NB600-533
Western Blot: Actin Gamma 1 Antibody [NB600-533] - Detection of human and mouse Cytoskeletal Actin by western blot. Samples: Whole cell lysate (15 ug) from HeLa, HEK293T, Jurkat, mouse TCMK-1, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-Cytoskeletal Actin antibody NB600-533 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Western Blot: Actin Gamma 1 Antibody [NB600-533] - Whole cell lysate from HeLa (1, 2.5, 5, 15 and 50 ug) and mouse NIH3T3 cells (50 ug), probed with diluted at 0.04 ug/ml.
Western Blot: Actin Gamma 1 Antibody [NB600-533] - Knockdown of DLK in differentiated Neuro-2a cells. Neuro-2a cells were infected with an empty lentiviral vector (pLKO.1) or with lentivirus expressing mouse DLK shRNAs (sh73 and sh69). After infection and selection with puromycin, cells were subjected to differentiation for 24 h before being processed for total RNA extraction and whole-cell extracts. Representative Western blots showing levels of DLK, phospho-JNK (p-JNK), total JNK, phospho-c-Jun (p-c-Jun) and actin in infected Neuro-2a cells. Image collected and cropped by CiteAb from the following publication (http://neuraldevelopment.biomedcentral.com/articles/10.1186/s13064-016-0068-8), licensed under a CC-BY licence.
(6 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
O-GlcNAc
Transferase p110 subu ...
NBP1-32791
Immunocytochemistry/Immunofluorescence: O-GlcNAc Transferase p110 subunit Antibody [NBP1-32791] - MCF7 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: O-GlcNAc transferase protein stained by O-GlcNAc transferase antibody ) diluted at 1:500. Red: phalloidin, a cytoskeleton marker, stained by phalloidin (invitrogen, A12380) diluted at 1:200.
Western Blot: O-GlcNAc Transferase p110 subunit Antibody [NBP1-32791] - A. 30 ug PC-12 whole cell extract 5 % SDS-PAGE O-GlcNAc transferase antibody dilution: 1:1000
Immunohistochemistry-Paraffin: O-GlcNAc Transferase p110 subunit Antibody [NBP1-32791] - Rat hind brain. O-GlcNAc transferase antibody diluted at 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(4 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB

Publications for PNPLA8 Antibody (NBP1-83098)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PNPLA8 Antibody (NBP1-83098) (0)

There are no reviews for PNPLA8 Antibody (NBP1-83098). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PNPLA8 Antibody (NBP1-83098) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PNPLA8 Products

Bioinformatics Tool for PNPLA8 Antibody (NBP1-83098)

Discover related pathways, diseases and genes to PNPLA8 Antibody (NBP1-83098). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PNPLA8 Antibody (NBP1-83098)

Discover more about diseases related to PNPLA8 Antibody (NBP1-83098).
 

Pathways for PNPLA8 Antibody (NBP1-83098)

View related products by pathway.

Blogs on PNPLA8

There are no specific blogs for PNPLA8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PNPLA8 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PNPLA8