PNPLA8 Antibody - BSA Free

Western Blot: PNPLA8 Antibody [NBP1-83098] - Analysis in human cell line U-2197.

Immunocytochemistry/Immunofluorescence: PNPLA8 Antibody [NBP1-83098] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PNPLA8 Antibody [NBP1-83098] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PNPLA8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PNPLA8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PNPLA8 Protein (NBP1-83098PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PNPLA8 Antibody - BSA Free

• calcium-independent phospholipase A2-gamma
• EC 3.1.1.5
• Intracellular membrane-associated calcium-independent phospholipase A2 gamma
• iPLA2 gamma
• IPLA22
• IPLA2-2
• iPLA2-gamma
• IPLA2GIPLA2(GAMMA)
• membrane-associated calcium-independent phospholipase A2 gamma
• patatin-like phospholipase domain containing 8
• Patatin-like phospholipase domain-containing protein 8
• PNPLA-gamma

Background

Phospholipase A2 catalyzes cleavage of fatty acids from phospholipids, thereby regulating membrane physical properties and the release of lipid second messengers and growth factors. Phospholipase A2 activity also modulates cellular growth programs, inflammation, and ion channel function (Mancuso et al., 2000 [PubMed 10744668]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PNPLA8 Antibody (NBP1-83098)(3)

Publications using NBP1-83098

• Menegaut L, Masson D, Abello N et al. Specific enrichment of 2-arachidonoyl-lysophosphatidylcholine in carotid atheroma plaque from type 2 diabetic patients. Atherosclerosis 2016-08-01 [PMID: 27189320] (IHC-P, Human)
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]
• Pattabiraman PP, Lih FB, Tomer KB, Rao PV. The role of calcium-independent phospholipase A2 gamma in modulation of aqueous humor drainage and Ca2+ sensitization of trabecular meshwork contraction. Am J Physiol Cell Physiol 2012-04-01 [PMID: 22237407]

Bioinformatics

• Gene Symbol: PNPLA8