Home » PNPLA8 » PNPLA8 Antibodies » PNPLA8 Antibody

PNPLA8 Antibody

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: PNPLA8 Antibody [NBP1-83098] - Analysis in human cell line U-2197.
Western Blot: PNPLA8 Antibody [NBP1-83098] - Analysis in human cell line U-2197.
Immunocytochemistry/ Immunofluorescence: PNPLA8 Antibody [NBP1-83098] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: PNPLA8 Antibody [NBP1-83098] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PNPLA8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENE
Specificity
Specificity of human PNPLA8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNPLA8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PNPLA8 Protein (NBP1-83098PEP)
Publications
Read Publications using
NBP1-83098 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22237407)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PNPLA8 Antibody

  • calcium-independent phospholipase A2-gamma
  • EC 3.1.1.5
  • Intracellular membrane-associated calcium-independent phospholipase A2 gamma
  • iPLA2 gamma
  • IPLA22
  • IPLA2-2
  • iPLA2-gamma
  • IPLA2GIPLA2(GAMMA)
  • membrane-associated calcium-independent phospholipase A2 gamma
  • patatin-like phospholipase domain containing 8
  • Patatin-like phospholipase domain-containing protein 8
  • PNPLA-gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PLA2G6 Antibody
H00008398-D01P
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in mouse kidney.
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in human kidney.
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in transfected 293T cell line by PLA2G6 polyclonal antibody.Lane 1: PLA2G6 transfected lysate(84.10 KDa).Lane 2: Non-transfected lysate.
Species: Hu, Mu
Applications: WB
PLA2G1B Antibody
NBP2-32569
Immunocytochemistry/Immunofluorescence: PLA2G1B Antibody [NBP2-32569] - Staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: PLA2G1B Antibody [NBP2-32569] - Staining in human pancreas and skeletal muscle tissues using anti-PLA2G1B antibody. Corresponding PLA2G1B RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PLA2G1B Antibody [NBP2-32569] - Staining of human pancreas shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PLA2G2A Antibody
[Unconjugated]
AF4925
Western blot shows lysates of mouse small intestine tissue. PVDF Membrane was probed with 0.5 µg/mL of Sheep Anti-Mouse PLA2G2A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4925) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for PLA2G2A at approximately 17 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
PLA2G2A was detected in perfusion fixed frozen sections of mouse intestine using Sheep Anti-Mouse PLA2G2A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4925) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells in intestinal glands. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of mouse small intestine tissue, loaded at 0.2 mg/mL. A specific band was detected for PLA2G2A at approximately 27 kDa (as indicated) using 5 µg/mL of Sheep Anti-Mouse PLA2G2A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4925) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Species: Mu
Applications: WB, Simple Western, IHC
PEDF R/PNPLA2/ATGL
Antibody
NB110-41536
Western Blot: ATGL Antibody [NB110-41536] - Detection of ATGL in human adipose tissue lysate.
Immunocytochemistry/Immunofluorescence: ATGL Antibody [NB110-41536] - ATGL antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Species: Hu, Mu
Applications: WB, ICC/IF
Acetyl-CoA
Carboxylase alpha/ACA ...
AF6898
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, C2C12 mouse myoblast cell line, and rat liver tissue. PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Human/Mouse/Rat Acetyl-CoA Carboxylase alpha /ACACA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6898) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Acetyl-CoA Carboxylase alpha /ACACA at approximately 250 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu, Rt
Applications: WB
AE Binding Protein
1/ACLP Antibody (5908 ...
MAB6425
HASMC human human aortic smooth muscle cells was stained with Human ACLP Monoclonal Antibody (Catalog # MAB6425, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: CyTOF-ready, ICFlow
Monoglyceride
Lipase Antibody (OTI2
NBP2-00735
Western Blot: Monoglyceride Lipase Antibody (2B11) [NBP2-00735] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Monoglyceride Lipase (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Monoglyceride Lipase.
Immunocytochemistry/Immunofluorescence: Monoglyceride Lipase Antibody (2B11) [NBP2-00735] - Staining of COS7 cells.
Immunohistochemistry-Paraffin: Monoglyceride Lipase Antibody (2B11) [NBP2-00735] - Staining of paraffin-embedded Human prostate tissue using anti-Monoglyceride Lipase mouse monoclonal antibody.
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
TEF1 Antibody
(13112)
NBP2-43581
Western Blot: TEF1 Antibody (13112) [NBP2-43581] - Analysis of whole cell extracts and extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with TEF1 antibody [13112] at a dilution of 1:500.
Immunocytochemistry/Immunofluorescence: TEF1 Antibody (13112) [NBP2-43581] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: TEF1 protein stained by TEF1 antibody [GT13112] diluted at 1:400. Red: Phalloidin, a F-actin marker, diluted at 1:200.
Immunoprecipitation: TEF1 Antibody (13112) [NBP2-43581] - Immunoprecipitation of TEF1 protein from HeLa nuclear extracts using 5 ug of TEF1 antibody [13112]. Western blot analysis was performed using TEF1 antibody [13112] EasyBlot anti-Mouse IgG was used as a secondary reagent.
Species: Hu
Applications: WB, ICC/IF, IP
14-3-3 zeta
Antibody (818515) [Un ...
MAB2669
Western blot shows lysates of SH‑SY5Y human neuroblastoma cell line,SK‑Mel‑28 human malignant melanoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, and C6 rat glioma cell line. PVDF membrane was probed with 0.2 µg/mL of Mouse Anti-Human14‑3‑3 zeta  Monoclonal Antibody (Catalog # MAB2669) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for14‑3‑3 zeta at approximately 27 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of SH‑SY5Y human neuroblastoma cell line, loaded at 0.5 mg/mL. A specific band was detected for 14‑3‑3 zeta at approximately 34 kDa (as indicated) using 2 µg/mL of Mouse Anti-Human 14‑3‑3 zeta Monoclonal Antibody (Catalog # MAB2669). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
14‑3‑3 zeta  was detected in immersion fixed paraffin-embedded sections of human squamous cell carcinoma using Mouse Anti-Human 14‑3‑3 zeta Monoclonal Antibody (Catalog # MAB2669) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to nuclei and plasma membrane. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
Species: Hu
Applications: WB, Simple Western, IHC
Phospholipase B1
Overexpression Lysate ...
H00151056-T01
Lane 1: PLB1 transfected lysate (46.64 KDa) Lane 2: Non-transfected lysate.
PLB1 transfected lysate.
Species: Hu
HRAS like
suppressor Antibody
NBP2-14101
Immunocytochemistry/Immunofluorescence: HRAS like suppressor Antibody [NBP2-14101] - Immunofluorescent staining of human cell line U-251 MG shows localization to focal adhesion sites.
Immunohistochemistry-Paraffin: HRAS like suppressor Antibody [NBP2-14101] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Arg-Vasopressin
Antibody
NB100-65214
Arg-Vasopressin Antibody
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
beta-3 Adrenergic
R/ADRB3 Antibody
H00000155-B01P
Western Blot: beta-3 Adrenergic R/ADRB3 Antibody [H00000155-B01P] - Analysis of ADRB3 expression in transfected 293T cell line by ADRB3 polyclonal antibody. Lane 1: ADRB3 transfected lysate(44.88 KDa). Lane 2: Non-transfected lysate.
Flow Cytometry: beta-3 Adrenergic R/ADRB3 Antibody [H00000155-B01P] - Analysis of negative control 293 cells (Black) and ADRB3 expressing 293 cells (Green) using ADRB3 purified MaxPab mouse polyclonal antibody.
(2 Publications)
Species: Hu
Applications: WB, Flow
beta-Actin
Antibody (AC-15)
NB600-501
Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - MCDK cells induced with C22H24N2O8 to control the expression of the gene of interest. Beta actin blocking confirms the albumin assay showing that an equal amount of lysate was loaded in each lane.
Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - beta-Actin expression in Fibroblast Hs68 cell lysate using anti-beta-Actin antibody. Image from verified customer review.
Simple Western: beta-Actin Antibody (AC-15) [NB600-501] - Analysis using the HRP conjugate of NB600-501. Simple Western lane view shows a specific band for Beta-Actin in 0.2 mg/ml of Hela, MCF-7, SH-SY5Y, & Jurkat lysate(s). This experiment was performed under reducing conditions using the 12-230kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(21 Reviews)
(299 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Proprotein
Convertase 7/PCSK7
2984-SE
Proprotein Convertase 7/PCSK7
Species: Hu
beta-Actin
Antibody (AC-15)
NB600-501
Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - MCDK cells induced with C22H24N2O8 to control the expression of the gene of interest. Beta actin blocking confirms the albumin assay showing that an equal amount of lysate was loaded in each lane.
Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - beta-Actin expression in Fibroblast Hs68 cell lysate using anti-beta-Actin antibody. Image from verified customer review.
Simple Western: beta-Actin Antibody (AC-15) [NB600-501] - Analysis using the HRP conjugate of NB600-501. Simple Western lane view shows a specific band for Beta-Actin in 0.2 mg/ml of Hela, MCF-7, SH-SY5Y, & Jurkat lysate(s). This experiment was performed under reducing conditions using the 12-230kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(21 Reviews)
(299 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
F-Actin Antibody
(NH3)
NB100-64792
Immunocytochemistry/Immunofluorescence: F-Actin Antibody (NH3) [NB100-64792] - The distribution of stress fiber was observed by F-actin staining. Image from verified customer review.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
O-GlcNAc
Transferase p110 subu ...
NBP1-32791
Western Blot: O-GlcNAc Transferase p110 subunit Antibody [NBP1-32791] - Mouse tissue extracts (50 ug) was separated by 7.5 % SDS-PAGE, and blotted with O-GlcNAc transferase antibody diluted by 1:2000
Immunocytochemistry/Immunofluorescence: O-GlcNAc Transferase p110 subunit Antibody [NBP1-32791] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: O-GlcNAc transferase protein stained by O- GlcNAc transferase antibody (GTX109939) diluted at 1:200.Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody [GT114] diluted at 1:1000.
Immunohistochemistry-Paraffin: O-GlcNAc Transferase p110 subunit Antibody [NBP1-32791] - Paraffin-embedded rat hind brain. O-GlcNAc transferase antibody diluted at 1:500.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for PNPLA8 Antibody (NBP1-83098)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PNPLA8 Antibody (NBP1-83098) (0)

There are no reviews for PNPLA8 Antibody (NBP1-83098). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PNPLA8 Antibody (NBP1-83098) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PNPLA8 Products

Bioinformatics Tool for PNPLA8 Antibody (NBP1-83098)

Discover related pathways, diseases and genes to PNPLA8 Antibody (NBP1-83098). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PNPLA8 Antibody (NBP1-83098)

Discover more about diseases related to PNPLA8 Antibody (NBP1-83098).
 

Pathways for PNPLA8 Antibody (NBP1-83098)

View related products by pathway.

Blogs on PNPLA8

There are no specific blogs for PNPLA8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PNPLA8 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PNPLA8