PNPLA8 Antibody

Images

 
Western Blot: PNPLA8 Antibody [NBP1-83098] - Analysis in human cell line U-2197.
Immunocytochemistry/ Immunofluorescence: PNPLA8 Antibody [NBP1-83098] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: PNPLA8 Antibody [NBP1-83098] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PNPLA8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNPLA8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PNPLA8 Protein (NBP1-83098PEP)
Publications
Read Publications using
NBP1-83098 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22237407)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PNPLA8 Antibody

  • calcium-independent phospholipase A2-gamma
  • EC 3.1.1.5
  • Intracellular membrane-associated calcium-independent phospholipase A2 gamma
  • iPLA2 gamma
  • IPLA22
  • IPLA2-2
  • iPLA2-gamma
  • IPLA2GIPLA2(GAMMA)
  • membrane-associated calcium-independent phospholipase A2 gamma
  • patatin-like phospholipase domain containing 8
  • Patatin-like phospholipase domain-containing protein 8
  • PNPLA-gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
AF4925
Species: Mu
Applications: WB, Simple Western, IHC
NB110-41536
Species: Hu, Mu
Applications: WB, ICC/IF
AF6898
Species: Hu, Mu, Rt
Applications: WB
MAB6425
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-00735
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-93369
Species: Hu
Applications: WB, PEP-ELISA
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
2984-SE
Species: Hu
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP1-32791
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for PNPLA8 Antibody (NBP1-83098)(3)

Reviews for PNPLA8 Antibody (NBP1-83098) (0)

There are no reviews for PNPLA8 Antibody (NBP1-83098). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PNPLA8 Antibody (NBP1-83098) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PNPLA8 Products

Bioinformatics Tool for PNPLA8 Antibody (NBP1-83098)

Discover related pathways, diseases and genes to PNPLA8 Antibody (NBP1-83098). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PNPLA8 Antibody (NBP1-83098)

Discover more about diseases related to PNPLA8 Antibody (NBP1-83098).
 

Pathways for PNPLA8 Antibody (NBP1-83098)

View related products by pathway.

Blogs on PNPLA8

There are no specific blogs for PNPLA8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PNPLA8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PNPLA8