PNMA3 Antibody

Images

 
Immunohistochemistry-Paraffin: PNMA3 Antibody [NBP2-13782] Staining of human vulva/anal skin shows strong cytoplasmic and membranous positivity in superficial layers of epidermal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PNMA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PRPPARITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSR GSRKRKRHTFCYSCG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNMA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PNMA3 Protein (NBP2-13782PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PNMA3 Antibody

  • MA3MA5
  • MGC132756
  • MGC132758
  • paraneoplastic antigen MA3
  • paraneoplastic cancer-testis-brain antigen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009240-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-89575
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47352
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13820
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82806
Species: Hu
Applications: WB, IHC, IHC-P
NB100-64347
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ft, Gt, GP, Mk, Rb
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83302
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
H00004330-Q01
Species: Hu
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PNMA3 Antibody (NBP2-13782) (0)

There are no publications for PNMA3 Antibody (NBP2-13782).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PNMA3 Antibody (NBP2-13782) (0)

There are no reviews for PNMA3 Antibody (NBP2-13782). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PNMA3 Antibody (NBP2-13782) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PNMA3 Products

Bioinformatics Tool for PNMA3 Antibody (NBP2-13782)

Discover related pathways, diseases and genes to PNMA3 Antibody (NBP2-13782). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PNMA3 Antibody (NBP2-13782)

Discover more about diseases related to PNMA3 Antibody (NBP2-13782).

Blogs on PNMA3

There are no specific blogs for PNMA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PNMA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PNMA3