PNKD Antibody


Immunocytochemistry/ Immunofluorescence: PNKD Antibody [NBP1-88348] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: PNKD Antibody [NBP1-88348] - Staining of human kidney shows cytoplasmic positivity in renal tubules.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

PNKD Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: REVDKDRVKQMKARQNMRLSNTGEYESQRFRASSQSAPSPDVGSGVQ
Specificity of human PNKD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PNKD Protein (NBP1-88348PEP)
Read Publication using NBP1-88348.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (83%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PNKD Antibody

  • BRP17FKSG19
  • DKFZp564N1362
  • DYT8paroxysmal nonkinesiogenic dyskinesia
  • FPD1brain protein 17
  • KIAA1184Myofibrillogenesis regulator 1
  • KIPP1184probable hydrolase PNKD
  • MGC31943
  • MR1Paroxysmal nonkinesiogenic dyskinesia protein
  • MR-1Trans-activated by hepatitis C virus core protein 2
  • paroxysmal nonkinesigenic dyskinesia
  • PDCEC 3.-


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq, Mk, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Ca
Applications: WB, Flow
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PNKD Antibody (NBP1-88348)(1)

Reviews for PNKD Antibody (NBP1-88348) (0)

There are no reviews for PNKD Antibody (NBP1-88348). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PNKD Antibody (NBP1-88348) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PNKD Products

Bioinformatics Tool for PNKD Antibody (NBP1-88348)

Discover related pathways, diseases and genes to PNKD Antibody (NBP1-88348). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PNKD Antibody (NBP1-88348)

Discover more about diseases related to PNKD Antibody (NBP1-88348).

Pathways for PNKD Antibody (NBP1-88348)

View related products by pathway.

PTMs for PNKD Antibody (NBP1-88348)

Learn more about PTMs related to PNKD Antibody (NBP1-88348).

Blogs on PNKD

There are no specific blogs for PNKD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PNKD Antibody and receive a gift card or discount.


Gene Symbol PNKD