PMS2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PMS2 Antibody [NBP2-56323] - Staining of human cell line HaCaT shows localization to nucleoplasm & cytoplasmic bodies.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PMS2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PMS2 Antibody - BSA Free (NBP2-56323) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MHAADLEKPMVEKQDQSPSLRTGEEKKDVSISRLREAFSLRHTTENKPHSPKTPEPRRS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PMS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PMS2 Recombinant Protein Antigen (NBP2-56323PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PMS2 Antibody - BSA Free

• DNA mismatch repair protein PMS2
• EC 3.1
• H_DJ0042M02.9
• HNPCC4postmeiotic segregation increased (S. cerevisiae) 2
• mismatch repair endonuclease PMS2
• PMS1 protein homolog 2
• PMS2 postmeiotic segregation increased 2 (S. cerevisiae)
• PMSL2PMS2CL

Background

PMS2 is one of the PMS2 gene family members found in clusters on chromosome 7. The product of this gene is involved in DNA mismatch repair. It forms a heterodimer with MLH1 and this complex interacts with other complexes bound to mismatched bases. Mutations in this gene are associated with hereditary nonpolyposis colorectal cancer, Turcot syndrome, and are a cause of supratentorial primitive neuroectodermal tumors. Alternatively spliced transcript variants have been observed for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PMS2