PMS1 Antibody (2G10)

Images

 
Sandwich ELISA: PMS1 Antibody (2G10) [H00005378-M01] - Detection limit for recombinant GST tagged PMS1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2G10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PMS1 Antibody (2G10) Summary

Immunogen
PMS1 (NP_000525, 26 a.a. - 135 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KELIENSLDAGATSVDVKLENYGFDKIEVRDNGEGIKAVDAPVMAMKYYTSKINSHEDLENLTTYGFRGEALGSICCIAEVLITTRTAADNFSTQYVLDGSGHILSQKPS
Specificity
PMS1 - PMS1 postmeiotic segregation increased 1 (S. cerevisiae)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PMS1
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PMS1 Antibody (2G10)

  • DKFZp781M0253
  • FLJ98259
  • HNPCC3
  • hPMS1
  • human homolog of yeast mutL
  • mismatch repair gene PMSL1
  • PMS1 postmeiotic segregation increased 1 (S. cerevisiae)
  • PMS1 protein homolog 1
  • PMSL1DNA mismatch repair protein PMS1
  • postmeiotic segregation increased (S. cerevisiae) 1
  • rhabdomyosarcoma antigen MU-RMS-40.10B
  • rhabdomyosarcoma antigen MU-RMS-40.10E

Background

This gene encodes a protein belonging to the DNA mismatch repair mutL/hexB family. This protein is thought to be involved in the repair of DNA mismatches, and it can form heterodimers with MLH1, a known DNA mismatch repair protein. Mutations in this gene cause hereditary nonpolyposis colorectal cancer type 3 (HNPCC3) either alone or in combination with mutations in other genes involved in the HNPCC phenotype, which is also known as Lynch syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56552
Species: Hu
Applications: WB
NB100-621
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-329
Species: Hu
Applications: WB, IHC, IP, PLA, RIA
NB100-56554
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready
AF2535
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55958
Species: Hu
Applications: ICC/IF
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16391
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-58116
Species: Hu
Applications: ICC/IF
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
H00005378-M01
Species: Hu
Applications: WB, ELISA

Publications for PMS1 Antibody (H00005378-M01) (0)

There are no publications for PMS1 Antibody (H00005378-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PMS1 Antibody (H00005378-M01) (0)

There are no reviews for PMS1 Antibody (H00005378-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PMS1 Antibody (H00005378-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PMS1 Products

Bioinformatics Tool for PMS1 Antibody (H00005378-M01)

Discover related pathways, diseases and genes to PMS1 Antibody (H00005378-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMS1 Antibody (H00005378-M01)

Discover more about diseases related to PMS1 Antibody (H00005378-M01).
 

Pathways for PMS1 Antibody (H00005378-M01)

View related products by pathway.

PTMs for PMS1 Antibody (H00005378-M01)

Learn more about PTMs related to PMS1 Antibody (H00005378-M01).
 

Research Areas for PMS1 Antibody (H00005378-M01)

Find related products by research area.

Blogs on PMS1

There are no specific blogs for PMS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PMS1 Antibody (2G10) and receive a gift card or discount.

Bioinformatics

Gene Symbol PMS1
Entrez
OMIM
Uniprot