PMP70 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PMP70 Antibody [NBP2-38199] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199] - Staining of human colon.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199] - Staining in human liver and skeletal muscle tissues using anti-ABCD3 antibody. Corresponding ABCD3 RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199] - Staining of human colon, kidney, liver and skeletal muscle using Anti-ABCD3 antibody NBP2-38199 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP2-38199] - Staining of human kidney.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PMP70 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGP
Specificity
Specificity of human PMP70 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PMP70 Antibody

  • 70 kDa peroxisomal membrane protein
  • ABC43
  • ATP-binding cassette, sub-family D (ALD), member 3
  • peroxisomal membrane protein 1 (70kD, Zellweger syndrome)
  • Peroxisomal membrane protein-1 (70kD)
  • PMP70ATP-binding cassette sub-family D member 3
  • PXMP1dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1))
  • ZWS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46476
Species: Hu
Applications: WB, IHC
NBP2-26123
Species: Hu
Applications: WB, PEP-ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-21601
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58327
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-49876
Species: Hu
Applications: WB, PEP-ELISA
NBL1-15012
Species: Hu
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-80950
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33455
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32925
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
H00008443-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-30032
Species: Hu, Mu, Bv, Ca, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-38443
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-87781
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for PMP70 Antibody (NBP2-38199) (0)

There are no publications for PMP70 Antibody (NBP2-38199).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PMP70 Antibody (NBP2-38199) (0)

There are no reviews for PMP70 Antibody (NBP2-38199). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PMP70 Antibody (NBP2-38199) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PMP70 Products

Array NBP2-38199

Bioinformatics Tool for PMP70 Antibody (NBP2-38199)

Discover related pathways, diseases and genes to PMP70 Antibody (NBP2-38199). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMP70 Antibody (NBP2-38199)

Discover more about diseases related to PMP70 Antibody (NBP2-38199).
 

Pathways for PMP70 Antibody (NBP2-38199)

View related products by pathway.

PTMs for PMP70 Antibody (NBP2-38199)

Learn more about PTMs related to PMP70 Antibody (NBP2-38199).
 

Research Areas for PMP70 Antibody (NBP2-38199)

Find related products by research area.

Blogs on PMP70

There are no specific blogs for PMP70, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PMP70 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCD3
Uniprot
COVID-19 update