PMEL17/SILV Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: PTAESTGMTPEKVPVSEVMGTTLAEMSTPEATGMTPAEVSIVVLSGTTAAQVTTTEWVETTARELPIPEPEGPDASSIMSTESITGSLGPLLDGTATLRLVKRQVPLDCVLYRYGSFSVTLDIVQGIESAEILQAV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PMEL |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PMEL17/SILV Antibody - BSA Free
Background
Melanoma gp100 a melanosomal matrix protein whose expression is closely correlated with cellular melanin content and which is a frequent melanoma tumor antigen recognized by cytotoxic T lymphocytes. It is a likely candidate gene for some cases of human oculocutaneous albinism not associated with known albinism loci.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Publications for PMEL17/SILV Antibody (NBP2-38185) (0)
There are no publications for PMEL17/SILV Antibody (NBP2-38185).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PMEL17/SILV Antibody (NBP2-38185) (0)
There are no reviews for PMEL17/SILV Antibody (NBP2-38185).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PMEL17/SILV Antibody (NBP2-38185) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PMEL17/SILV Products
Blogs on PMEL17/SILV